KEGG   Enterobacter asburiae LF7a: Entas_0240Help
Entry
Entas_0240        CDS       T01604                                 

Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00620  Pyruvate metabolism
eas00630  Glyoxylate and dicarboxylate metabolism
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01200  Carbon metabolism
Module
eas_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Entas_0240
   00630 Glyoxylate and dicarboxylate metabolism
    Entas_0240
Enzymes [BR:eas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Entas_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: AEN62995
UniProt: G2SA27
Position
263641..265242
Genome map
AA seq 533 aa AA seqDB search
MTQQATTADELAFNQPHGEQEQQILTPEAVEFLTELVTRFTPKRNKLLAARIHQQQEIDD
GKLPGFISETTSIRRSDWTIRGIPEDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKSLLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFDLPR
GTIKATLLIETLPAVFQMNEILHALRDHIVGLNCGRWDYIFSYIKTLKNHADRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKELEARNG
HDGTWIAHPGLADTAMEVFNRVLRDNKNQLFVTREEDAPTAEEQLLAPCTGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKSLFR
QMLAEEMLVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaaccacggccgatgaactggcctttaaccagccgcatggcgaacaa
gaacagcaaatcttaacgccagaagccgtcgaattcctgaccgagctggtgacccgcttt
acgccaaagcgcaataaactgctggcggcacgcatccatcaacagcaggaaattgacgat
ggcaagttgcctgggtttatttcggaaactacttccattcgtcgtagcgactggacaatc
cgcggcattcctgaagatttgcaggatcgtcgcgtcgagatcaccggcccggtagagcgc
aaaatggtgattaacgccatgaatgctaacgttaaagtcttcatggccgattttgaagat
tctctggctccggactggcgaaaagtcatcgacgggcaaatcaacctgcgtgatgccgtg
aacggcaccatcagctataccaacgaagccgggaaaatctaccagctcaaaccgaacccg
gctgttctgatttgccgtgtacgtggcctgcatctgcctgaaaagcatgtcacctggcgc
ggtgaagccatccctggcagcctgttcgattttgccctctatttcttccacaactacaaa
agcttgttggcgaaaggcagcggcccctatttctacctgccaaaaactcaggcctggcag
gaagcggcctggtggagtgaagtctttagctatgcagaggatcgtttcgacctgccgcgc
ggcaccatcaaagccacgctgttaattgaaacgctgccggcggtcttccagatgaacgaa
attctgcacgcgctgcgcgaccacattgttggcctgaactgcggacgctgggattacatc
tttagctacatcaaaaccctgaaaaatcacgccgaccgcgtgctgccggatcgtcaggtt
gtcaccatggacaaaccgttcctcagcgcttattcgcgtctgctgattaagacctgccac
aagcgcggtgcgtttgcgatgggcggtatggcggcatttattccaagcaaagatgccgag
cgaaacaaccaggtgctcaacaaggtgaaagccgataaagagctggaagcacgtaacggc
catgatggcacgtggattgcacacccgggcctggccgatacggcgatggaggtgttcaac
cgcgtactgagggacaacaaaaaccagctgtttgtcacgcgcgaagaggatgcaccaacc
gcagaagagcagctgctggcgccttgtacgggtgaacgcaccgaagaggggatgcgcgcc
aatattcgcgttgccgtgcagtacatcgaagcgtggatctccggtaacggctgcgtgcca
atctacggtctgatggaagatgccgccacggcggagatctcccgcacctctatctggcag
tggatccatcaccaaaaaacgctcagtaacggtaagccggtaaccaaatccctgttccgc
cagatgctggccgaagagatgctggttatccaggacgaactgggcgagcaccgcttcagc
agcgggcgttttgacgacgctgcgcgcctgatggagcaaatcaccacatcagatgactta
atcgacttcctcaccctgccaggctaccgcctgcttgcgtaa

DBGET integrated database retrieval system