KEGG   Enterobacter asburiae LF7a: Entas_0240Help
Entry
Entas_0240        CDS       T01604                                 

Definition
malate synthase A
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entas_0240
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Entas_0240
   00630 Glyoxylate and dicarboxylate metabolism
    Entas_0240
Enzymes [BR:eas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Entas_0240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
263641..265242
Genome map
AA seq 533 aa AA seqDB search
MTQQATTADELAFNQPHGEQEQQILTPEAVEFLTELVTRFTPKRNKLLAARIHQQQEIDD
GKLPGFISETTSIRRSDWTIRGIPEDLQDRRVEITGPVERKMVINAMNANVKVFMADFED
SLAPDWRKVIDGQINLRDAVNGTISYTNEAGKIYQLKPNPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKSLLAKGSGPYFYLPKTQAWQEAAWWSEVFSYAEDRFDLPR
GTIKATLLIETLPAVFQMNEILHALRDHIVGLNCGRWDYIFSYIKTLKNHADRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNNQVLNKVKADKELEARNG
HDGTWIAHPGLADTAMEVFNRVLRDNKNQLFVTREEDAPTAEEQLLAPCTGERTEEGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHQKTLSNGKPVTKSLFR
QMLAEEMLVIQDELGEHRFSSGRFDDAARLMEQITTSDDLIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacaggcaaccacggccgatgaactggcctttaaccagccgcatggcgaacaa
gaacagcaaatcttaacgccagaagccgtcgaattcctgaccgagctggtgacccgcttt
acgccaaagcgcaataaactgctggcggcacgcatccatcaacagcaggaaattgacgat
ggcaagttgcctgggtttatttcggaaactacttccattcgtcgtagcgactggacaatc
cgcggcattcctgaagatttgcaggatcgtcgcgtcgagatcaccggcccggtagagcgc
aaaatggtgattaacgccatgaatgctaacgttaaagtcttcatggccgattttgaagat
tctctggctccggactggcgaaaagtcatcgacgggcaaatcaacctgcgtgatgccgtg
aacggcaccatcagctataccaacgaagccgggaaaatctaccagctcaaaccgaacccg
gctgttctgatttgccgtgtacgtggcctgcatctgcctgaaaagcatgtcacctggcgc
ggtgaagccatccctggcagcctgttcgattttgccctctatttcttccacaactacaaa
agcttgttggcgaaaggcagcggcccctatttctacctgccaaaaactcaggcctggcag
gaagcggcctggtggagtgaagtctttagctatgcagaggatcgtttcgacctgccgcgc
ggcaccatcaaagccacgctgttaattgaaacgctgccggcggtcttccagatgaacgaa
attctgcacgcgctgcgcgaccacattgttggcctgaactgcggacgctgggattacatc
tttagctacatcaaaaccctgaaaaatcacgccgaccgcgtgctgccggatcgtcaggtt
gtcaccatggacaaaccgttcctcagcgcttattcgcgtctgctgattaagacctgccac
aagcgcggtgcgtttgcgatgggcggtatggcggcatttattccaagcaaagatgccgag
cgaaacaaccaggtgctcaacaaggtgaaagccgataaagagctggaagcacgtaacggc
catgatggcacgtggattgcacacccgggcctggccgatacggcgatggaggtgttcaac
cgcgtactgagggacaacaaaaaccagctgtttgtcacgcgcgaagaggatgcaccaacc
gcagaagagcagctgctggcgccttgtacgggtgaacgcaccgaagaggggatgcgcgcc
aatattcgcgttgccgtgcagtacatcgaagcgtggatctccggtaacggctgcgtgcca
atctacggtctgatggaagatgccgccacggcggagatctcccgcacctctatctggcag
tggatccatcaccaaaaaacgctcagtaacggtaagccggtaaccaaatccctgttccgc
cagatgctggccgaagagatgctggttatccaggacgaactgggcgagcaccgcttcagc
agcgggcgttttgacgacgctgcgcgcctgatggagcaaatcaccacatcagatgactta
atcgacttcctcaccctgccaggctaccgcctgcttgcgtaa

DBGET integrated database retrieval system