KEGG   Enterobacter asburiae: Entas_0241Help
Entry
Entas_0241        CDS       T01604                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
eas  Enterobacter asburiae
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:eas01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:eas00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
265274..266578
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGIRRPYSAEEVVKLRGSVNPECTLAQLGAAKMWRLLHGG
SKKGYINSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLASSMYPDQSLYPANSVPSV
VERINNTFRRADQIQWSAGIEPNDPRFVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVLGVPTLVIARTDADAADL
ITSDCDPYDSEFITGERTSEGFYRTHAGIEQAISRGLAYAPYADLVWCETSTPDLALAKR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFEAGKEGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEEAQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacacgtacccaacagatcgaagaattacaaaaagagtggacacagccgcgctgg
gaaggcattcgtcgcccttacagcgccgaggaagtggtgaaattacgtggctcggtcaat
ccggagtgcacgctggcgcagctgggtgcggcaaaaatgtggcgtctgctgcatggcggt
tcaaaaaaaggctatatcaacagcctgggggcgctgacgggtggtcaggcgctgcaacag
gcgaaggcgggtattgaggcggtttacctgtcgggctggcaagtggcagcggatgccaac
ctcgcctccagtatgtacccggatcaatcgctctatccggcaaactctgtgccgtcagtg
gtggagcggatcaacaacaccttccgtcgtgcggatcagatccaatggtctgcgggcatt
gagccaaacgatccgcgttttgtggattacttcctgccgatcgtcgccgatgcagaagcc
ggtttcggtggcgtgctgaatgcctttgagctgatgaaatcgatgattgaggccggtgca
gcggccgtacacttcgaagatcagctggcatcggtgaagaagtgcggacatatgggcggt
aaagtgctggttccgactcaggaagcgattcagaaactggttgcagcgcgtctggctgcg
gatgttctgggggttccgacgctggtgattgctcgtaccgatgcagacgcggctgacctg
atcacctctgactgcgacccgtacgatagcgagttcattaccggcgagcgtaccagcgaa
ggcttctaccgcacccatgctggcattgaacaggctatcagccgcggtctggcctatgca
ccgtatgcggacctggtgtggtgtgaaacctcaacaccggatctggcgctggcaaaacgc
tttgccgatgctattcatgcgaaataccccggcaaactgctggcctataactgttcgcca
tccttcaactggcagaagaatctggacgataaaacgatcgccagcttccagcaacagctg
tcggatatgggctacaaataccagttcatcaccctggcgggtattcacagcatgtggttc
aacatgttcgacctggcccacgcttatgcgcagggcgagggcatgaagcactatgttgag
aaagtacaacagccagagttcgaggccggtaaagagggctatacctttgtttctcaccag
caggaggtgggaacaggctacttcgataaagtcaccaccatcattcaggggggcgcctcc
tctgtgacggccttaacgggatcgacggaagaagcacagttctga

DBGET integrated database retrieval system