KEGG   Enterobacter asburiae LF7a: Entas_0312Help
Entry
Entas_0312        CDS       T01604                                 

Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00010  Glycolysis / Gluconeogenesis
eas00620  Pyruvate metabolism
eas00640  Propanoate metabolism
eas00680  Methane metabolism
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
eas01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_0312
   00620 Pyruvate metabolism
    Entas_0312
   00640 Propanoate metabolism
    Entas_0312
  Energy metabolism
   00680 Methane metabolism
    Entas_0312
Enzymes [BR:eas01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Entas_0312
Lipid biosynthesis proteins [BR:eas01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Entas_0312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEN63066
UniProt: G2S0L3
Position
complement(339709..341667)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHDIPANIADRCLINPEQYHEKYQQSVSSPDIFWGEQGHILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLAERGNETAIIWEGDDASQSKHITYKELHRDVCRF
AKVLLEQGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIVDSNS
KLVITADEGVRAGRGIPLKKNVDEALKNPNVKSVSNVVVLKRTGGKIDWKEGRDLWWSDL
IENASDQHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPMPGATQLKAGSATNPFFGVQPALVDNEGHPLEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatccataaacacgacattcccgcaaatattgcggaccgttgcctgatcaac
ccggagcagtaccacgagaagtatcagcaatccgtctccagcccggatatcttctggggt
gaacagggtcatattcttgactggatcaaaccttatcagaaggtgaaaaacacctccttt
gcgccaggtaacgtctccattaaatggtatgaagatggcacactgaacctggcggcgaac
tgtctggatcgccatcttgccgaacgtgggaacgagacggctatcatctgggaaggcgac
gacgcttctcagagcaaacacattacctataaagagttgcaccgtgacgtgtgccgcttt
gccaaagtgctgctggagcagggcattaaaaaaggcgacgtcgtggcgatttatatgcca
atggtaccggaagcggcggtggccatgctggcgtgcgcgcgcatcggcgccattcactcc
gtcatcttcggcggcttctcgccagaagcggttgccggtcgtattgtcgattcaaattct
aaactggtgatcaccgccgatgaaggcgtgcgcgccggtcgcggtattccgctgaagaaa
aacgtcgacgaagcgctgaaaaacccgaacgtgaaaagcgtcagcaacgttgtggtgctc
aagcgtaccggcggcaagatcgactggaaagagggtcgcgacctgtggtggagcgatctg
attgaaaacgcaagcgaccagcaccagccagaagagatgaacgcggaagacccgctgttt
atcctttatacctctggctctaccggcaaaccaaaaggcgtattgcataccactggcggc
tatctggtttatgcggcaaccaccttcaaatatgtgttcgactaccacccgggtgacatc
tactggtgtaccgccgatgtgggttgggtcaccgggcacagctacctgctttacggcccg
ctggcctgcggcgcgaccaccctgatgtttgaaggcgtaccgaactggccgaccccggcg
cgtatgtgccaggtggtcgacaaacacaaggtcaacattctctataccgcgccaacggcg
atccgcgcgctgatggcggaaggcgacaaagccatcgaaggcactgaccgctcttccctg
cgcattctcggttccgtgggcgagcctatcaacccggaagcctgggagtggtactggaag
aaaatcggtaacgagaaatgcccggtgatggacacctggtggcagaccgaaacgggcggc
ttcatgatcaccccgatgccgggtgcgacccagctgaaagcgggttctgcaaccaaccca
ttcttcggcgtacaacctgcactggtggataacgaaggccatccgcttgaaggggcaacc
gaaggtaacctggtcatcaccgactcctggcctggccaggcgcgtaccctgttcggcgat
cacgagcgcttcgagcagacctacttctccacctttaaaaacatgtacttcagcggcgac
ggcgcgcgtcgtgatgaagacggttactactggataaccggacgtgtggacgatgtgctg
aacgtttccggccaccgtctgggtacggcggagattgaatctgcactggtgtcgcatccg
aagattgccgaagccgccgtggtgggtatcccgcataacattaagggccaggcgatttac
gcatacgttacgctgaaccacggtgaagagccgtcgccagagctgtatgccgaggtgcgc
aactgggtacgtaaagagattggcccgcttgccacaccggatgttctgcactggacggac
tccctgccgaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcc
ggtgacaccagtaacctcggtgatacttcaacgctcgccgatccaggtgtggtggaaaaa
ctgctcgaagagaagcaggccatcgcaatgccatcgtaa

DBGET integrated database retrieval system