KEGG   Enterobacter asburiae LF7a: Entas_0312Help
Entry
Entas_0312        CDS       T01604                                 

Definition
acetyl-coenzyme A synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entas_0312
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_0312
   00620 Pyruvate metabolism
    Entas_0312
   00640 Propanoate metabolism
    Entas_0312
  Energy metabolism
   00680 Methane metabolism
    Entas_0312
Enzymes [BR:eas01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Entas_0312
Lipid biosynthesis proteins [BR:eas01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Entas_0312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(339709..341667)
Genome map
AA seq 652 aa AA seqDB search
MSQIHKHDIPANIADRCLINPEQYHEKYQQSVSSPDIFWGEQGHILDWIKPYQKVKNTSF
APGNVSIKWYEDGTLNLAANCLDRHLAERGNETAIIWEGDDASQSKHITYKELHRDVCRF
AKVLLEQGIKKGDVVAIYMPMVPEAAVAMLACARIGAIHSVIFGGFSPEAVAGRIVDSNS
KLVITADEGVRAGRGIPLKKNVDEALKNPNVKSVSNVVVLKRTGGKIDWKEGRDLWWSDL
IENASDQHQPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHKVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVMDTWWQTETGG
FMITPMPGATQLKAGSATNPFFGVQPALVDNEGHPLEGATEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHNIKGQAIYAYVTLNHGEEPSPELYAEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaatccataaacacgacattcccgcaaatattgcggaccgttgcctgatcaac
ccggagcagtaccacgagaagtatcagcaatccgtctccagcccggatatcttctggggt
gaacagggtcatattcttgactggatcaaaccttatcagaaggtgaaaaacacctccttt
gcgccaggtaacgtctccattaaatggtatgaagatggcacactgaacctggcggcgaac
tgtctggatcgccatcttgccgaacgtgggaacgagacggctatcatctgggaaggcgac
gacgcttctcagagcaaacacattacctataaagagttgcaccgtgacgtgtgccgcttt
gccaaagtgctgctggagcagggcattaaaaaaggcgacgtcgtggcgatttatatgcca
atggtaccggaagcggcggtggccatgctggcgtgcgcgcgcatcggcgccattcactcc
gtcatcttcggcggcttctcgccagaagcggttgccggtcgtattgtcgattcaaattct
aaactggtgatcaccgccgatgaaggcgtgcgcgccggtcgcggtattccgctgaagaaa
aacgtcgacgaagcgctgaaaaacccgaacgtgaaaagcgtcagcaacgttgtggtgctc
aagcgtaccggcggcaagatcgactggaaagagggtcgcgacctgtggtggagcgatctg
attgaaaacgcaagcgaccagcaccagccagaagagatgaacgcggaagacccgctgttt
atcctttatacctctggctctaccggcaaaccaaaaggcgtattgcataccactggcggc
tatctggtttatgcggcaaccaccttcaaatatgtgttcgactaccacccgggtgacatc
tactggtgtaccgccgatgtgggttgggtcaccgggcacagctacctgctttacggcccg
ctggcctgcggcgcgaccaccctgatgtttgaaggcgtaccgaactggccgaccccggcg
cgtatgtgccaggtggtcgacaaacacaaggtcaacattctctataccgcgccaacggcg
atccgcgcgctgatggcggaaggcgacaaagccatcgaaggcactgaccgctcttccctg
cgcattctcggttccgtgggcgagcctatcaacccggaagcctgggagtggtactggaag
aaaatcggtaacgagaaatgcccggtgatggacacctggtggcagaccgaaacgggcggc
ttcatgatcaccccgatgccgggtgcgacccagctgaaagcgggttctgcaaccaaccca
ttcttcggcgtacaacctgcactggtggataacgaaggccatccgcttgaaggggcaacc
gaaggtaacctggtcatcaccgactcctggcctggccaggcgcgtaccctgttcggcgat
cacgagcgcttcgagcagacctacttctccacctttaaaaacatgtacttcagcggcgac
ggcgcgcgtcgtgatgaagacggttactactggataaccggacgtgtggacgatgtgctg
aacgtttccggccaccgtctgggtacggcggagattgaatctgcactggtgtcgcatccg
aagattgccgaagccgccgtggtgggtatcccgcataacattaagggccaggcgatttac
gcatacgttacgctgaaccacggtgaagagccgtcgccagagctgtatgccgaggtgcgc
aactgggtacgtaaagagattggcccgcttgccacaccggatgttctgcactggacggac
tccctgccgaaaacccgctccggcaaaattatgcgccgtattctgcgcaaaattgcggcc
ggtgacaccagtaacctcggtgatacttcaacgctcgccgatccaggtgtggtggaaaaa
ctgctcgaagagaagcaggccatcgcaatgccatcgtaa

DBGET integrated database retrieval system