KEGG   Enterobacter asburiae LF7a: Entas_0381Help
Entry
Entas_0381        CDS       T01604                                 

Definition
mechanosensitive ion channel MscS
Orthology
K05802  
potassium efflux system protein
Organism
eas  Enterobacter asburiae LF7a
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(408298..411621)
Genome map
AA seq 1107 aa AA seqDB search
MRPIIVLLMAWCLSMGAYAATAPDAKQITQELEQAKAAKPAQPETVESLQAALNALEERK
GSLERAQQYQQVIDNFPKLSQTLRSQLNNLRDEPREVPAGMTSDALNQEILQVSSQLLEK
SRMAQQEQERAREIADSLNQLPQQQTDARRQLSEVERRVGTQTGNTPLNQAQNLAIQAES
ARLKALVDELELAQLSANNRQELSRMRSELAQKQSEQLDAWLQTLRNQLNSQRQREAEKA
LESTELLAENSDNLPVGIVDQFKVNRELSAALNQQAQRMDLVASQQRQATNQTLQVRQAL
NTLREQSQWLGSSNLLGEALRAQVARLPEMPKPQQLDTEMAQLRVQRLHFEDLLNKQPQI
RQIRQADGQPLTSEQNRILDAQMRTQRELLNSLLQGGDTLILELTKLKVSNSQLEDALKE
VNEATHRYLFWTSDVRPMTFSWPIEIVQDLRRLISLDTFSQLGQASVMMLTSKETIFPLL
GALILVGCSIYSRRHFTRFLERSSARVGKVTQDHFWLTLRTVFWSILVASPLPVLWMTLG
YGLREAWPYPLAVAIGDGVTATVPLLWVVMICATFARPNGLFIAHFGWPRNRVARAMRYY
LMSIGLIVPLIMALIMFDNLNDREFSGSLGRLCFMLICGALAMVKLSLKRAGIPLYLDKT
GSGDNMFNRLLWNLMLSAPLLAILAAAVGYLATAQALLARLETSVAIWFLLLVVYHVIRR
WMLIQRRRLAFDRAKHRRAEILAQRARGEEESHHTNSTEGNTDADDVELDLDAISTQSLR
LVRSILMLIALLSVIFLWSEIHSAFGFLENISLWDVTSTVQGVESLEPITLGAVLIAILV
LIITTQLIRNFPALLELALLQHLDLAPGTGYAITTITKYLIMLFGGLVGFSMIGIEWSKL
QWLVAALTVGLGFGLQEIFANFVSGLIILFEKPIRIGDTVTIRDLTGSVTRINTRATTIS
DWDRKEIIVPNKAFITEQFINWSLSDSVTRVVLTVPAPSDANSEEVTQILYTAAERCSLV
IDNPAPEVFLVDLQQGIQIFELRIYAAEMGHRMPLRHEIHQLILAGFREHGIDMPFPPFQ
MRLESLDGRKTARTVTSAARKRPAGSL
NT seq 3324 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcccgattatcgtactactgatggcctggtgcctcagcatgggggcgtacgcagcg
acagcccccgacgccaaacagataacccaggagctggagcaggcaaaagcggcaaaaccc
gcgcagcctgaaaccgtcgaatcgctccaggccgcgctgaacgcgctcgaggaacgcaaa
ggttcccttgagcgtgctcagcaatatcagcaggttatcgataacttccccaaactttcg
caaacgctgcgctcgcagttgaataacctgcgcgatgaaccgcgcgaggtgcctgcgggc
atgacctccgacgcgcttaatcaggagatcctgcaagtcagcagccagcttctggaaaag
agtcgtatggctcagcaggagcaggagcgcgcacgtgaaattgccgattcgctcaaccag
cttccacaacagcaaaccgatgcccgccgccagctcagtgaagttgagcgacgtgtcggg
acacagaccggtaataccccgcttaaccaggcgcagaatcttgccattcaggctgaatcc
gccagactcaaagccctggtggatgagctggagctggcgcaactgtctgccaacaaccgc
caggagctgtcgcggatgcgttccgagctggcgcaaaagcagagtgagcagcttgatgcc
tggttacagaccctgcgtaaccagctaaacagccagcgccagcgtgaagctgaaaaagcg
ctggaaagcacggaattacttgccgaaaacagcgataacctgcccgtcgggattgtcgat
cagtttaaggttaaccgcgagctttctgccgccctgaaccagcaagcacagcgtatggat
ctggtggcgtcgcaacagcgtcaggccactaaccaaaccttgcaggtacgtcaggcgctg
aataccctgcgcgagcaatcccagtggcttggctcctcaaacctgctgggcgaagcatta
cgcgcgcaggttgcacgcttgccggaaatgccaaagccacaacagcttgatactgaaatg
gcacaactgcgcgtccagcgcctgcattttgaagatctcctcaacaaacagccgcaaatc
cgccagatccgtcaggccgacgggcagccgctgaccagtgagcaaaaccgcattctggac
gcgcagatgcgcacccaacgcgagctgctgaattcactgcttcagggtggcgatacgctt
atcctcgagctcaccaagctgaaagtgtctaacagccagcttgaagatgcgctgaaagag
gtgaacgaggcgacgcaccgctacctgttctggacttccgacgtccgcccgatgaccttc
tcctggccaattgaaatcgtgcaggatctgcgccgccttatttcactggataccttcagc
cagttgggccaggccagcgtgatgatgctcaccagcaaagagacgatcttcccgctgctg
ggggcattgattctggtgggttgcagtatttattcgcgcaggcactttacccgcttcctg
gagcgctccagtgcgcgcgtcggcaaggtgacgcaggatcacttctggctaacgctacgc
acggtattctggtcgattctcgttgcctcgccgctgccggtgctgtggatgacgctcggc
tacggcctgcgggaggcctggccttatccgctggcggtggcgattggcgatggtgtgacc
gccaccgttccgctgctgtgggtggtgatgatttgcgccacgtttgcccgtccgaacggc
ctgttcatagcccactttggctggccgcggaatcgcgtggcgcgcgccatgcgttattac
ctgatgagcatcgggcttatcgtgcctctgatcatggcgcttatcatgttcgataacctc
aatgaccgtgaattctccggctcgttgggtcgtctgtgctttatgctgatttgcggcgcg
ctggcgatggttaagctcagcctcaaacgtgccggtattccgctgtatctcgataaaacc
ggcagcggcgataacatgttcaaccgcctgctgtggaacctgatgctctctgctccactg
ctcgcgatcctggcggcagccgtgggttatctggctactgcgcaggcgctgctggcgcgg
ctggaaacgtcagtcgccatctggttcctgctcctggtggtctaccacgttattcgccga
tggatgcttatccagcgccgcaggctggcgttcgaccgtgccaagcaccgccgcgcggag
atcctcgcgcagcgtgcccgaggtgaagaggaatcgcaccataccaacagcacggaaggg
aacaccgatgcggatgatgttgaactggatctcgatgctatcagtacccagtccctgcga
ctggtacgctcgatcctgatgctgattgccctgctctcggtgattttcctgtggtctgag
atccactctgcatttggcttcctcgaaaacatctcgctgtgggatgtcacgtcgacggta
cagggtgttgaaagccttgagcctatcaccctgggcgcggtgctgattgcgattctggtg
ctgatcatcaccacgcagcttatccgtaacttccctgctctgctggaactggcgctgctg
caacacctggatttagcgccaggtacgggctatgccattaccaccatcaccaaatatctg
atcatgctgtttggtgggctggttgggttctcgatgattggtattgagtggtcgaagcta
cagtggctggttgctgccctcaccgttggcctgggctttggcttgcaggagattttcgcc
aactttgtttccggcctgatcatcctgtttgaaaaaccgatccgtatcggcgatacggtg
acgatccgcgacttgaccggcagtgtcaccaggatcaacacccgtgcgacgacgatcagc
gactgggatcgtaaagagatcatcgtgccaaataaggcgtttatcaccgagcagtttatc
aactggtcgttgtcagactccgttacgcgtgtggtgctgaccgtgcctgcgccatcagat
gcaaacagcgaagaggtgacgcaaatcctgtacaccgccgcagagcgctgctcgctggtg
atagacaacccggcaccggaagtcttcctggtcgatttgcagcaggggatccagattttc
gagctgcgtatttatgcggctgaaatggggcatcgaatgccgctgcgccacgagatccac
cagctgattctggcaggcttccgcgagcacggtatcgatatgccgttccctccattccag
atgcgcctggaaagtctggatggtcgtaagacggcaagaacggtgacatcagcggcgcgt
aagcgcccggcgggaagtttgtag

DBGET integrated database retrieval system