KEGG   Enterobacter asburiae: Entas_0468Help
Entry
Entas_0468        CDS       T01604                                 

Definition
glycoside hydrolase family protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
eas  Enterobacter asburiae
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eas00520]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:eas00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
504736..507120
Genome map
AA seq 794 aa AA seqDB search
MLRYSLLTAGLMLGASAFAAPAGDLPLMPWPAKVERPTTQGALVLSDNISVSVSGDDLGD
AVNRLRQRIALQTGWTLRPQADKPDKPTIRIDIAKKVKPQPLPDSDESYTLKVDADGVNI
SANTRFGALRGMETLLQLIQNGPENTAIPWVTIEDAPRFPWRGLLLDSARHFIPLNDIKR
QIDGMAAAKLNVLHWHLTDDQGWRFTSKRYPKLTQLASDGQFYTPDQMREIVRYATDRGI
RVVPEIDMPGHASAIAVAYPELMSAPGPYEMERHWGVLKPVLDPTKEATYTFAEAMVSEL
AAIFPDPYLHIGGDEVDDTQWKQNAAIQKFMRDNKLADSHALQAYFNRKLETILEKHHRQ
MVGWDEIFHPDLPKSILIQSWQGQDALGQVAEKGYKGILSTGFYLDQPQSTAYHYRNEIV
PQGLNNVDVIGDNDSPQSWSFTLPRLKGKPVEGSFTLVKGDSGWRGFIDFAGKSRRAVQN
IEWRSDDQVTFTVDTWMGETRPVVTVSTDTLSGYFLLGNARYPVSGKLLDEVPKGIAPVV
PDTAQQANLLGGEAALWAENVVAPVLDIKLWPRAFAVAERLWSAQDVNDTDNMYTRLQAM
DSWSTVSVGLLQHSQQQAYFTRLANNGDSLPLQILAQAVEPAQYYTRQHLKFQAGNYHQF
EPLNRFADALSAESATVRQMNKWVDRLVSDAEDTESADALRHVFNRWQSNTSDALALSGS
NYQLKAIKPVIQEVDKLASIGLRLTDLVARQGTLDDKEIASIQAELDNAAKIQDEVVIAA
VYPLETLLRATRNQ
NT seq 2385 nt NT seq  +upstreamnt  +downstreamnt
atgttacggtacagcctcttaaccgccgggcttatgctcggcgcttctgcgtttgccgct
ccggcaggtgacctccccctgatgccctggcctgcaaaggttgaacgcccgacaacacag
ggcgcgctggtgctcagcgataacatttccgttagcgtcagcggtgacgatctgggtgac
gcggttaaccgcctgcgccagcgcattgcgctgcaaaccggctggacactccggccgcag
gccgataagccagacaaacctaccatccgcatcgacattgctaaaaaggtgaagccgcaa
ccgctgcccgacagcgatgagagctacacgcttaaggtagacgctgacggcgtgaacatc
tcggccaacacccgttttggcgcgctgcgcgggatggaaacgctgcttcagcttatccag
aacgggccagaaaataccgcgataccctgggtcaccattgaggatgcgccgcgtttcccg
tggcgtggtttgctgcttgattccgcccgccactttatcccgctgaacgacatcaaacgg
cagattgacggaatggcggcggcaaaactgaacgtgctgcactggcatctgactgacgat
cagggctggcgatttacctcgaagcgctatccaaagctcacgcagcttgccagcgacgga
cagttttacaccccggaccagatgcgcgagatcgtgcgctacgctaccgaccgtggcatt
cgcgtggtcccggaaatcgacatgccgggccatgcgtcggcaattgccgttgcctacccc
gagctgatgagcgcaccggggccttatgaaatggagcgccactggggcgtgctgaaaccg
gtgctggatcctaccaaagaggcgacgtatacctttgcagaggcaatggtcagcgaactg
gcggcgatcttccccgatccctatctgcatattggtggcgatgaggtagacgacacgcag
tggaaacaaaacgccgccattcagaaattcatgcgtgacaacaaactggcggacagccat
gcattgcaggcgtatttcaaccgcaagctggaaacgatcctcgaaaaacatcaccggcag
atggtgggctgggacgaaatcttccatcccgacctgccaaaaagcattctgatccagtcc
tggcaagggcaggacgcgctggggcaggtggccgaaaaaggctacaaaggcattctctcg
accggtttttacctcgaccagccacagtctactgcctatcactaccgcaatgagattgtg
ccgcagggcttaaacaatgtggatgtgattggcgataacgacagcccgcagagctggtct
ttcaccctgccgcgcctgaaaggcaagccggtggaagggagctttacgctagtgaaaggc
gattccggctggcgaggatttattgattttgccgggaagtcgcgccgcgcggttcagaat
atcgaatggcgtagcgacgaccaggtgacctttaccgtcgatacctggatgggcgaaacg
cgcccggtggtgacggtgagcacggatacgctgagcggctatttcctgctgggcaacgcc
cgttacccggtcagcggcaagctgctggatgaggtgccaaaaggtatcgccccggtcgtg
cccgatactgcccagcaggccaatctgctgggtggcgaagccgcgctgtgggccgaaaac
gtggtggcgccggtgctggatattaaactctggccgcgcgcgtttgccgtggcggaacgc
ttgtggtcggcacaggacgtgaacgataccgacaacatgtacacccgtttgcaggcgatg
gatagctggtcaacggtgtcggtggggcttttgcagcacagccagcagcaggcgtacttc
acccgcctggcgaacaatggcgacagcctgccgctgcagatcctcgcgcaggcggtggag
ccagcccagtattacacccgtcagcacctgaaattccaggccgggaattaccatcagttt
gagccgctcaaccgttttgccgatgcgctaagcgctgaaagcgcaaccgtgcgtcagatg
aataaatgggtcgacaggctggtgagcgatgccgaagacacggaaagtgcggatgcgctg
cgccacgtgtttaatcgctggcagagcaataccagcgatgcgctggcgctgagcggaagc
aattatcagctgaaagccattaaaccggtgattcaggaagtggataagctggcgtcgatt
gggttgcgcttaaccgatctggtggcgcgtcaggggacgctggatgataaagaaattgcg
tcgattcaggcggagctagataacgcggcgaaaatccaggatgaagtggtgatagcggcg
gtttacccgctggagacgctgctgcgcgcgacgcgcaatcagtaa

DBGET integrated database retrieval system