KEGG   Enterobacter asburiae LF7a: Entas_0588Help
Entry
Entas_0588        CDS       T01604                                 

Definition
Thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Entas_0588
Enzymes [BR:eas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Entas_0588
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
625204..626526
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTVSEGQIAALAMTIFFHDMSMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYIPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYELSAQLAEAIVGVSNGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGKLAKDDAEARAKL
HAVLDNGKAAEIFGRMVAAQKGPTDFVENYAKYLPTATLSKAVYADTEGFISTMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMVRLGDSVDGQRPLAVIHAKDENSWQEAAKAVKAA
ITLDDKAPESSPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaaacgtgatggtcatgcattaagcgacgaa
gagatccgcttttttatcaacggcattcgcgataataccgtctctgaagggcaaattgct
gctctggcgatgaccatcttcttccatgatatgtcgatgcctgagcgtgtctcgttgacc
atggcgatgcgagattctgggaccgttctggactggaaaagcctcaaccttaacggcccg
attgttgataaacactctaccggcggtgtgggtgacgttacctcactgatgcttggccca
atggttgcggcctgtggcggttatattccgatgatctccgggcgcggcctgggtcacacc
ggcggcacgctggacaaactggaagccattccgggcttcgacatcttcccggatgacaat
cgcttccgcgaaattattaaagacgttggtgtggcaattatcggccagaccagctctctt
gcaccggcagacaagcgtttctacgccacccgcgatattaccgcgaccgttgactccatc
ccgctgatcaccgcctcaatcctcgccaaaaaactggcggaaggcctggatgcgctggtg
atggacgtgaaagtgggcagcggtgcgtttatgccaacctatgaactttctgcccagctt
gccgaagcgatcgttggtgtctccaacggtgctggcgtgcgcaccactgcgctgctgacg
gacatgaatcaggtgctggcatccagcgcaggtaacgctgttgaagtgcgtgaagccgtg
cagttcctgacgggtgaataccgtaacccacgtctgttcgacgtcaccatggcactgtgc
gttgagatgcttatctccggcaagcttgccaaagatgacgccgaggcgcgggcgaaattg
cacgccgtgctggataacggcaaagcggcggagatcttcggtcgcatggtagccgcgcag
aaaggcccaaccgatttcgtggaaaactacgcgaaatacctgccaaccgcgacgctcagc
aaggcggtttatgccgatacggaaggctttatttctacaatggacactcgtgcgcttggt
atggctgtggtgtcgatgggcggcggtcgccgtcaggcttcggacacgattgattacagt
gttggctttaccgacatggttcgcctgggcgacagcgttgacggccaacgtccgctggcg
gttatccacgcgaaagatgaaaacagctggcaggaagcggcgaaggcggtgaaagcggcc
attacgcttgacgataaagcaccagaaagctcaccttcggtctatcgtcgcatcactgaa
taa

DBGET integrated database retrieval system