KEGG   Enterobacter asburiae: Entas_0685Help
Entry
Entas_0685        CDS       T01604                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
eas  Enterobacter asburiae
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Class
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:eas00300]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:eas00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
736818..738305
Genome map
AA seq 495 aa AA seqDB search
MADRNLRDLLAPWVPNAPERALREMVLDSRMAASGDLFVAVVGHQADGRRYIPQAIAQGV
AAIIAEAKDEATDGEIREMHGVPVIYLSQLSERLSALAGRFYHEPSDQLRLIGVTGTNGK
TTTTQLMAQWAQLLGETSAVMGTVGNGLLGKVNPTENTTGSAVDVQHVLAGLAGQGATFA
AMEVSSHGLVQHRVAALRFAASVFTNLSRDHLDYHGDMEHYEAAKWLLYSTHHCGQAIIN
ADDEVGRRWLAKLPDAVAVSMEDHINPNCHGRWLKAVEVNYHDSGATIRFSSSWGDGEIE
SRLMGAFNVSNLLLALATLLALGYPMAELLKTAERLQPVCGRMEVFSAPGKPTVVVDYAH
TPDALEKALEAARLHCAGKLWCVFGCGGDRDKGKRPLMGAIAEQFADIPVVTDDNPRTEE
PRAIINDILAGMLDAGRARVVEGRAEAVTNTIMQAQENDVVLLAGKGHEDYQIVGARRLD
YSDRVTAARLLGVVA
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtggcagatcgtaatttgcgcgaccttctcgctccgtgggtgccaaatgcaccggagcga
gcactgcgggagatggtactggacagccgtatggctgcttctggcgatctttttgtagcg
gtggtcggtcatcaggcggacgggcgtcgatatatcccgcaggcgattgcgcaaggtgta
gctgccattattgctgaggcgaaagatgaagcaaccgacggtgaaatccgtgaaatgcat
ggcgtgccggtcatctatctcagccagttaagcgaacgcctttccgcactggcggggcgt
ttctatcatgaaccttctgaccagttacgcctgattggcgtgaccgggaccaacggtaaa
accacgaccacgcagttaatggcgcagtgggcgcagctgctgggtgaaaccagtgcggtg
atggggaccgtgggcaatggcctgctgggcaaagtgaacccaacggaaaataccacaggt
tctgcggtagacgtgcagcatgtgctggcgggtctggcagggcagggtgcaacgtttgcc
gcaatggaagtctcctcacacgggctggtacagcaccgcgtagcggcactgaggtttgca
gcttccgtgtttactaacctgagccgtgaccacctcgactatcacggtgatatggagcat
tacgaagcggcaaaatggctgctctactccacgcatcactgcggacaggcaatcatcaac
gccgacgacgaagtgggccgccgctggctggctaagctgccggatgcggttgcggtctcc
atggaagatcatattaaccctaactgtcacggccgctggctgaaggcggttgaggtgaac
tatcacgacagcggggccaccattcgctttagctcttcatggggtgacggcgagattgaa
agccgcctgatgggggcgtttaacgtcagcaacctgttgctggcactggcaacgttactg
gcgctgggctatccgatggctgagctgctgaaaactgctgagcgcctgcaaccggtttgc
ggccgaatggaagtgttcagcgcgccaggtaaaccgaccgtggtggtggattacgctcat
acgccggatgcactggaaaaagcgctggaagcggcccgtctgcactgtgccggtaaactc
tggtgtgtctttggctgcggcggcgatcgcgataaaggcaaacgtccgctgatgggcgcc
attgctgaacagttcgcggatattccggttgtgaccgatgacaacccgcggactgaagag
ccgcgcgccatcatcaatgacattctggcaggaatgctggacgcaggccgtgcgcgtgtt
gttgaaggccgtgccgaagcagtgacgaataccattatgcaggcccaggagaacgacgtg
gttctgctggccggtaaaggccatgaagattatcagattgtcggggctcgccgtctggat
tattcagaccgcgtgaccgcagcacgtctgctgggagtggtggcatga

DBGET integrated database retrieval system