KEGG   Enterobacter asburiae LF7a: Entas_0846Help
Entry
Entas_0846        CDS       T01604                                 

Definition
Arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Entas_0846
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Entas_0846
Enzymes [BR:eas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Entas_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(921228..922091)
Genome map
AA seq 287 aa AA seqDB search
MSNDLRLIFPLWLGGNLREYHFGAQMLAWLAPETASPVEQVPVTPLDEQPGIEEGILGRS
KLMQDLDNASAIIRKHQPERITVLGGDCLIDLEPFAWLSERYGDGLGILWIDTHPDVMTP
AQYANAHAHVLGALMGNGDSDLTRRVPRPVPASRVMIAGLHSPNACEADFIRTKGIRTVS
PEAIRAGSQDIANWIAAEKITHLAIHFDLDVLDFHQFRAVMFARPDDAPGKWDGVAKGKL
TLAEAAAVIAQADGAADVVGLGIAEHLPWDAINLKNLLATLPLLRKA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacctacgattgatcttcccgctctggctgggcggaaaccttcgtgaatac
cattttggcgcacagatgctggcatggctggcccccgaaaccgcctcccctgttgaacag
gttcccgtgacaccgctggatgaacagccgggtattgaagaaggcattcttgggcgcagc
aaactgatgcaagatttggacaatgcctctgccatcattcgaaaacaccagccagaacgc
attaccgttctcgggggcgactgcctgatcgaccttgagcctttcgcctggctcagcgag
cgctatggtgatgggttgggtattttgtggatagatacccacccggatgtgatgaccccc
gcgcaatacgcaaatgcccatgcacatgttctcggcgcgttgatgggtaatggcgacagc
gatcttactcgccgcgtcccgcgccctgttccggccagccgggtgatgattgccggtctt
cattcaccgaatgcctgtgaagccgattttattcgtacaaaggggatccggaccgtctcg
cccgaggccatccgcgcaggcagtcaggacattgccaactggatcgccgcagagaagatc
acacacctggcgatccactttgatcttgatgtccttgattttcatcagttccgcgcagtg
atgtttgcacgcccggacgacgcgccggggaaatgggatggcgtagccaaaggcaaactc
acgcttgccgaagcggcggcggtaattgcgcaggcagacggtgctgctgacgtggtcggt
ttagggattgcggaacatttaccctgggatgccatcaacctgaaaaacctgctggcaacg
ttaccgctgcttcggaaggcgtaa

DBGET integrated database retrieval system