KEGG   Enterobacter asburiae LF7a: Entas_0846Help
Entry
Entas_0846        CDS       T01604                                 

Definition
(GenBank) Arginase/agmatinase/formiminoglutamase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00220  Arginine biosynthesis
eas00330  Arginine and proline metabolism
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01130  Biosynthesis of antibiotics
eas01230  Biosynthesis of amino acids
Module
eas_M00134  Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Entas_0846
   00330 Arginine and proline metabolism
    Entas_0846
Enzymes [BR:eas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Entas_0846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase Peptidase_M17_N
Motif
Other DBs
NCBI-ProteinID: AEN63594
UniProt: G2S927
Position
complement(921228..922091)
Genome map
AA seq 287 aa AA seqDB search
MSNDLRLIFPLWLGGNLREYHFGAQMLAWLAPETASPVEQVPVTPLDEQPGIEEGILGRS
KLMQDLDNASAIIRKHQPERITVLGGDCLIDLEPFAWLSERYGDGLGILWIDTHPDVMTP
AQYANAHAHVLGALMGNGDSDLTRRVPRPVPASRVMIAGLHSPNACEADFIRTKGIRTVS
PEAIRAGSQDIANWIAAEKITHLAIHFDLDVLDFHQFRAVMFARPDDAPGKWDGVAKGKL
TLAEAAAVIAQADGAADVVGLGIAEHLPWDAINLKNLLATLPLLRKA
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgagcaacgacctacgattgatcttcccgctctggctgggcggaaaccttcgtgaatac
cattttggcgcacagatgctggcatggctggcccccgaaaccgcctcccctgttgaacag
gttcccgtgacaccgctggatgaacagccgggtattgaagaaggcattcttgggcgcagc
aaactgatgcaagatttggacaatgcctctgccatcattcgaaaacaccagccagaacgc
attaccgttctcgggggcgactgcctgatcgaccttgagcctttcgcctggctcagcgag
cgctatggtgatgggttgggtattttgtggatagatacccacccggatgtgatgaccccc
gcgcaatacgcaaatgcccatgcacatgttctcggcgcgttgatgggtaatggcgacagc
gatcttactcgccgcgtcccgcgccctgttccggccagccgggtgatgattgccggtctt
cattcaccgaatgcctgtgaagccgattttattcgtacaaaggggatccggaccgtctcg
cccgaggccatccgcgcaggcagtcaggacattgccaactggatcgccgcagagaagatc
acacacctggcgatccactttgatcttgatgtccttgattttcatcagttccgcgcagtg
atgtttgcacgcccggacgacgcgccggggaaatgggatggcgtagccaaaggcaaactc
acgcttgccgaagcggcggcggtaattgcgcaggcagacggtgctgctgacgtggtcggt
ttagggattgcggaacatttaccctgggatgccatcaacctgaaaaacctgctggcaacg
ttaccgctgcttcggaaggcgtaa

DBGET integrated database retrieval system