KEGG   Enterobacter asburiae LF7a: Entas_0962Help
Entry
Entas_0962        CDS       T01604                                 

Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Entas_0962
  Lipid metabolism
   00600 Sphingolipid metabolism
    Entas_0962
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Entas_0962
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Entas_0962
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1042502..1045594
Genome map
AA seq 1030 aa AA seqDB search
MSNTSPLTLSAILARRDWENPGVTQWNRLAAHAPFHSWRDEQHARDEQKALNKRSLNGEW
RFNFYAAPERVPQEWVDENCDDAVPMPVPSNWQMQGFDTPIYTNVTYPFAVNPPFVPQEN
PTGCYSLTFEVDDAWLLSGQTRIIFDGVNSAFHLWCNGHWIGYSQDSRLPAEFDLSTVLR
PGLNRVAVMVLRWCDGSYLEDQDMWRMSGIFRDVSLLHKPETQIADYHVVTELNTELDRA
VLRVDVALAGSQYAECDVALTLWRNGEPCATATQRPGSEIVDERGNWAERFTVSMPVVAP
ALWSAEIPALYRLTISLRDAQGRVIECEACDVGFRRVEISNGLLKLNGKPLLIRGANRHE
HHPENGQVMDEATMRRDIELLKQHNFNAVRCSHYPNHPLWYTLCDRYGLYVVDEANIETH
GMVPMSRLADDPRWLPAMSERVTRMVLRDRNHTSIIIWSLGNESGHGANHDALYRWLKTT
DPTRPVQYEGGGANTAATDIVCPMYARVDQDQPFPAVPKWSIKKWIGMPDETRPLILCEY
AHAMGNSFGGFAKYWQAFRTHPRLQGGFVWDWVDQALTKKDESGNAFWAYGGDFGDKPND
RQFCLNGLVFPDRTPHPALYEAQRAQQFFTFSLVSTLPLVIEIKSDYLFRNTDNEQLRWT
ITREGNVLGAGDITLNMAPQGTQHVEIALPELQAAPGDVWLNAEVYQMQSTPWSSANHRC
AWEQWPLPAPLYIAPAPLPGVTPLLTVKETVLEITHQQQRWHFDRVSGDLTQWWNEGAET
LLSPLTDNFTRAPLDNDIGVSEATRIDPNAWVERWKAAGMYDVSARLLQCDGEQHSGDVV
VSTLHAWEHQGKTLFLSRKSWRVDSNGVLHGDVRVQVASDIPEPARIGLDCQLAQTPETV
SWQGLGPHENYPDRKLAAQQGRWALPLEALQTPYIFPTENGLRCDTRALEFGAHQFAGDF
HFSLSRYSQQQLRDTTHQHLLREEPGCWLNLDAFHMGVGGDDSWSPSVSPEFILHTRQLH
YTFSWQQKTQ
NT seq 3093 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaacacatcgccgctgacactcagcgcaattctggctcgtcgggactgggaaaat
cctggtgttacacagtggaaccggctggcggcccacgcgccgtttcacagctggcgtgat
gaacaacacgccagggatgagcaaaaagccttgaataagcgttctcttaacggggagtgg
cgtttcaacttttatgccgcgccagagcgtgttccgcaagaatgggtagatgaaaactgc
gacgacgctgttccgatgcccgtgccgtctaactggcagatgcagggctttgatacccca
atttataccaacgtcacttacccttttgccgttaacccgccctttgtcccgcaagaaaac
cctacaggttgttattcgctcacatttgaggtggacgatgcatggctgttgagcgggcag
acccgaattatctttgatggggtgaattcagcttttcatctgtggtgtaacggccactgg
attggctattcccaggacagccgtctgcctgctgagtttgatctctcgaccgttcttcgt
ccgggcctgaaccgcgtagcagtcatggtgctgcgctggtgtgacgggagctatcttgaa
gatcaggacatgtggcggatgagcggtatcttccgggatgtgtcgttactgcataagccg
gaaacgcagattgcggattaccatgttgtcactgagttaaataccgaattagaccgggcg
gtgctcagggtggacgtggcacttgccggaagccaatacgctgagtgtgacgtggcgctt
accctgtggcgaaacggtgagccgtgcgccacggcaacccagcgccccggctcggaaatt
gtggatgagcgcggcaactgggccgagcgctttacggtgtcgatgcctgttgtggcacct
gcattatggagcgccgaaattccggcgctgtatcgcctgacaatttcgctgagggacgcg
caggggcgggtcatcgagtgcgaggcctgtgacgtgggctttcgtcgtgtagagataagc
aacggcctgcttaaactcaatggcaaaccgttactgattcgcggcgctaaccgccatgaa
catcaccctgaaaacgggcaggtgatggatgaagccaccatgcgccgcgacatcgagttg
ctgaagcagcacaactttaacgcggtgcgatgttcgcattatcccaaccatccgctgtgg
tacacgctttgcgatcgctatggcctgtacgtggtagatgaagccaacattgaaacgcac
ggcatggtgccgatgagccgtctggctgacgatccgcgctggttgcccgccatgagcgaa
cgcgtcacccgcatggtgctgcgcgaccgtaatcatacgtcgattattatctggtcgctc
ggaaacgaatccggccacggtgctaaccacgatgcgctctaccgctggctgaaaaccacc
gatccgacccgtccggtgcaatacgaaggcggtggtgcaaataccgccgcaaccgacata
gtgtgcccgatgtatgcgcgcgttgatcaggatcagccgttcccggccgtaccgaaatgg
tcaatcaagaaatggatcgggatgccggatgaaacacgtccgctgatcttgtgcgaatac
gctcatgcgatgggcaacagtttcggtggctttgcaaaatactggcaggcgtttcgtacc
cacccgcgtttacagggcgggttcgtctgggactgggttgaccaggcgctgacgaagaaa
gacgaaagcggcaatgcgttctgggcgtatggtggtgattttggtgataagccgaatgac
cgacagttttgcctgaacggcctggtgttccctgaccgcacgccgcatccggcattgtat
gaagcccagcgcgcgcagcaattcttcacctttagcctggtaagtaccttgccactggtg
attgagattaaaagtgactacctgttccgcaacaccgacaacgaacagctgagatggacg
atcacccgggaagggaatgtgctgggagcgggcgacattaccctgaatatggccccgcag
ggtacacagcatgtagagatcgcactgccagaattacaggctgcgccgggtgacgtttgg
ctgaatgccgaggtgtaccagatgcaaagcacgccgtggtcgtcggcaaatcatcgctgt
gcctgggagcagtggccgcttcctgcgccactgtatattgcgccagccccgctgccgggc
gtgacgccgttgttaacggtgaaagagacggtgctggaaattacccatcagcaacagcgc
tggcactttgaccgtgtttcaggggatctgacgcagtggtggaatgagggcgctgaaacc
ctgctttccccgctaacggataactttacccgtgcgccgctggataatgatattggcgtg
agtgaggccacccgcattgatcctaatgcctgggtcgagcgctggaaagcggcgggcatg
tacgatgtgtctgcccggttattgcagtgtgacggtgaacagcatagcggcgatgttgtt
gtcagcacgcttcatgcctgggaacaccagggcaaaacgctgttccttagccgcaaaagc
tggcgggtcgatagcaacggggtattgcacggtgatgtgcgggtgcaggttgcatctgat
attcctgagcctgcgcgtatcgggctggattgtcagcttgcccaaacgcctgaaaccgtg
agctggcaggggcttgggccgcacgaaaactacccggaccgaaaactggctgcgcaacag
gggcgctgggcgttaccgcttgaggccctgcaaacgccttatattttcccgacggagaat
ggcttgcgttgcgatacccgtgcgctggaatttggcgctcatcagttcgccggggatttc
catttctcgttgagtcgctacagccagcaacagctgcgtgataccacacatcagcatctg
ctgagggaagagccggggtgctggttaaatctggatgctttccatatgggcgtgggtggc
gatgattcgtggagcccgagcgtgtcgccagaatttatcctgcacacccgccagttgcac
tacacctttagctggcagcaaaagacgcagtaa

DBGET integrated database retrieval system