KEGG   Enterobacter asburiae LF7a: Entas_0984Help
Entry
Entas_0984        CDS       T01604                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
eas  Enterobacter asburiae LF7a
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Entas_0984
DNA repair and recombination proteins [BR:eas03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Entas_0984
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067102..1067707
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLKSETIKEVILATNPTVEGEATANYIAELCAEAGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgctcacgcagttaatggaagcactgcgctgcctgccgggcgtt
ggcccgaagtcagcgcagcgcatggcgttcacgctcttgcagcgcgaccgcagcggcggg
atgcgcctggcgcaggctttaacccgcgccatgtcagaaattggtcattgtgcggattgc
cgtacgtttaccgagcaagacgtctgtaacatctgttcaaacccgcgtcgtcaggaaaac
ggtcagatttgcgtggtggagagtccggcggacatctacgctatcgaacaaaccgggcag
ttttcggggcgctatttcgtgctgatggggcatctctctccgctggacggtattggcccg
gatgatatcggtcttgaccgccttgaacagcgtcttaagtccgaaacgatcaaagaggtg
atcctcgccaccaacccaacggtggaaggggaggcaacggccaactacatcgccgaactg
tgcgcagaggcaggcgttgatgccagccgtatcgcccacggcgtaccggttggcggcgag
ctggaaatggtcgatggcaccacgctatcgcactctctggccggacgtcacaagattact
ttctga

DBGET integrated database retrieval system