KEGG   Enterobacter asburiae: Entas_0984Help
Entry
Entas_0984        CDS       T01604                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
eas  Enterobacter asburiae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eas03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1067102..1067707
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDVCNICSNPRRQENGQICVVESPADIYAIEQTGQFSGRYFVLMGHLSPLDGIGP
DDIGLDRLEQRLKSETIKEVILATNPTVEGEATANYIAELCAEAGVDASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHKITF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagtccgctgctcacgcagttaatggaagcactgcgctgcctgccgggcgtt
ggcccgaagtcagcgcagcgcatggcgttcacgctcttgcagcgcgaccgcagcggcggg
atgcgcctggcgcaggctttaacccgcgccatgtcagaaattggtcattgtgcggattgc
cgtacgtttaccgagcaagacgtctgtaacatctgttcaaacccgcgtcgtcaggaaaac
ggtcagatttgcgtggtggagagtccggcggacatctacgctatcgaacaaaccgggcag
ttttcggggcgctatttcgtgctgatggggcatctctctccgctggacggtattggcccg
gatgatatcggtcttgaccgccttgaacagcgtcttaagtccgaaacgatcaaagaggtg
atcctcgccaccaacccaacggtggaaggggaggcaacggccaactacatcgccgaactg
tgcgcagaggcaggcgttgatgccagccgtatcgcccacggcgtaccggttggcggcgag
ctggaaatggtcgatggcaccacgctatcgcactctctggccggacgtcacaagattact
ttctga

DBGET integrated database retrieval system