KEGG   Enterobacter asburiae: Entas_1004Help
Entry
Entas_1004        CDS       T01604                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
eas  Enterobacter asburiae
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:eas01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1090527..1091129)
Genome map
AA seq 200 aa AA seqDB search
MPFLFLILLTFRAAAADTLLVLGDSLSAGYRMAANAAWPALLNDKWQTKTPVINGSISGD
TSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRTILQDIKAANAKPLLM
QIRLPANYGRRYNEAFSAIYPKLAKEFDIPLLPFFMEEVYLKPQWMQDDGIHPNHDAQPF
IADWMATRLAPLVKHDSSHS
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgcccttcctgtttttgattctgttgaccttccgcgcggcagcggcagatacgttgctg
gtactgggtgacagcctgagcgccggctatcgcatggccgctaacgctgcgtggcctgcg
ctgcttaatgacaaatggcagacaaaaacaccggtcattaatggcagcatcagcggcgat
acttcacaacaggggctggcgcgtctgcctgcccttctcaaacaacatcagccacgttgg
gtgctggtggagcttggcggtaatgacggattgcgcggcttccagccacagcagacggaa
caaacgctgcgcactattttgcaggacataaaggccgcgaatgcaaaaccgttgctcatg
caaattcgtctgcccgccaactacggtcgtcggtataatgaggcctttagcgcgatctac
ccgaagcttgccaaagagtttgatattccgctgctgccatttttcatggaagaggtctat
ctgaaaccccaatggatgcaagacgacggtatccaccccaatcacgatgctcagccgttt
attgccgactggatggcaacacgactggcccctttagttaaacatgactcgtcacacagc
tga

DBGET integrated database retrieval system