KEGG   Enterobacter asburiae LF7a: Entas_1205Help
Entry
Entas_1205        CDS       T01604                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entas_1205
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Entas_1205
  Amino acid metabolism
   00310 Lysine degradation
    Entas_1205
Enzymes [BR:eas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Entas_1205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1314699..1315925
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVKRDEVLVEIETDKVVLEVPASADGVLDAV
LEDEGTTVTSRQILGRLREGNSAGKESSAKSDEKASTPAQRQQASLEEQSNDALSPAIRR
LLAEHNLDAAAIKGTGVGGRLTREDIEKHLAKAPAKAEAEAKAPAAAPAAQPALGARSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGDAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDTLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgttcccgacctgcctgaatctgtagcagatgcgactgtc
gccacctggcacaaaaaaccgggcgatgccgttaagcgcgatgaagtgctggtagaaatc
gaaactgacaaagtggtactggaagtaccggcttcggcggatggcgttctggatgcagtg
ctggaagatgaaggcaccaccgtaacctctcgtcagatcctgggtcgcctgcgtgaaggc
aacagcgcgggcaaagagtccagcgctaagtctgatgagaaagcctctaccccagcgcag
cgtcagcaggcctctctggaagagcagagcaacgatgcactcagcccggcgatccgtcgc
ctgctggctgagcacaacctggacgcggctgccattaaaggcaccggtgtgggtggtcgt
ctgactcgcgaagacattgagaaacacctggcgaaagcgcctgcgaaagcggaagcagaa
gccaaagcccctgcggcagcgccagcggcacagcctgctctgggcgcacgcagtgaaaaa
cgcgtaccgatgactcgtctgcgtaagcgtgtggctgagcgtctgctggaagcgaaaaac
tccaccgcgatgctgaccaccttcaacgaagtgaacatgaagccaatcatggacctgcgt
aagcagtacggtgacgcgtttgaaaaacgtcacggtatccgtctgggctttatgtccttc
tacgtaaaagcggttgttgaagcgctgaaacgctacccggaagtgaacgcgtctatcgat
ggcgatgacgtggtttaccacaactatttcgacgtcagcatggcggtttctaccccacgt
ggcctggtaacgccagttctgcgtgatgtggataccctgggtatggcagacatcgagaaa
aatattaaagagctggcagtgaaaggccgtgatggcaagctgactgtagacgacctgacc
ggcggtaacttcaccattaccaacggcggtgtattcggttcactgatgtctacgccgatc
atcaacccaccgcagagcgcgatcctggggatgcacgccatcaaagatcgtccgatggcg
gtagacggtaaagttgagatcctgccaatgatgtatctggcgctctcttacgatcaccgt
ctgatcgatggccgcgagtccgtcggcttcctggtagccattaaagagctgctggaagat
ccaacgcgtctgctgctcgacgtctag

DBGET integrated database retrieval system