KEGG   Enterobacter asburiae LF7a: Entas_1227Help
Entry
Entas_1227        CDS       T01604                                 

Definition
(GenBank) 2,3-bisphosphoglycerate-dependent phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00010  Glycolysis / Gluconeogenesis
eas00260  Glycine, serine and threonine metabolism
eas00680  Methane metabolism
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
eas01200  Carbon metabolism
eas01230  Biosynthesis of amino acids
Module
eas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eas_M00002  Glycolysis, core module involving three-carbon compounds
eas_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_1227
  Energy metabolism
   00680 Methane metabolism
    Entas_1227
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entas_1227
Enzymes [BR:eas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Entas_1227
Membrane trafficking [BR:eas04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    Entas_1227
Exosome [BR:eas04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Entas_1227
  Exosomal proteins of melanoma cells
   Entas_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEN63973
UniProt: G2S2T7
Position
complement(1338747..1339499)
Genome map
AA seq 250 aa AA seqDB search
MAITKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPQTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKFLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctattactaagctggttctggtgcgccacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtacgatgttgacctgtccgagaaaggcgtaagcgaagcaaaagca
gcaggtaaactgctgaaggaagaaggcttcagctttgattttgcttacacctctgtgctg
aaacgtgccatccacactctgtggaacgttctggacgagctggatcaggcatggctgcca
gttgagaaatcctggaaactgaacgagcgtcactacggtgctctgcaaggcctgaacaaa
gctgaaaccgctgagaaatacggtgacgagcaagttaaacagtggcgtcgtggcttcgca
gtgactccaccagagctgaccaaagatgacgagcgttacccgggccacgatccgcgctat
gcgaagctgaccgatgctgaactgccacagaccgaaagcctggcgctgaccatcgaccgc
gttgtgccttactggaacgaaaccattctgccacgcctgaaaagcggtgagcgcgttatc
atcgcagctcacggtaactccctgcgcgcgctggtgaaattcctggataacatgggtgaa
gacgagatcctcgaactgaacatcccaactggcgtgccgctggtatacgagttcgacgaa
aacttcaaaccaatcaaacactactatctgggtaacgctgacgaaatcgctgcaaaagcg
gcggccgtagcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system