KEGG   Enterobacter asburiae LF7a: Entas_1227Help
Entry
Entas_1227        CDS       T01604                                 

Definition
(RefSeq) 2,3-bisphosphoglycerate-independent phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entas_1227
   01230 Biosynthesis of amino acids
    Entas_1227
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_1227
  Energy metabolism
   00680 Methane metabolism
    Entas_1227
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entas_1227
Enzymes [BR:eas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Entas_1227
Exosome [BR:eas04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Entas_1227
  Exosomal proteins of melanoma cells
   Entas_1227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1338747..1339499)
Genome map
AA seq 250 aa AA seqDB search
MAITKLVLVRHGESQWNNENRFTGWYDVDLSEKGVSEAKAAGKLLKEEGFSFDFAYTSVL
KRAIHTLWNVLDELDQAWLPVEKSWKLNERHYGALQGLNKAETAEKYGDEQVKQWRRGFA
VTPPELTKDDERYPGHDPRYAKLTDAELPQTESLALTIDRVVPYWNETILPRLKSGERVI
IAAHGNSLRALVKFLDNMGEDEILELNIPTGVPLVYEFDENFKPIKHYYLGNADEIAAKA
AAVANQGKAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atggctattactaagctggttctggtgcgccacggcgaaagccagtggaacaacgaaaac
cgctttaccggttggtacgatgttgacctgtccgagaaaggcgtaagcgaagcaaaagca
gcaggtaaactgctgaaggaagaaggcttcagctttgattttgcttacacctctgtgctg
aaacgtgccatccacactctgtggaacgttctggacgagctggatcaggcatggctgcca
gttgagaaatcctggaaactgaacgagcgtcactacggtgctctgcaaggcctgaacaaa
gctgaaaccgctgagaaatacggtgacgagcaagttaaacagtggcgtcgtggcttcgca
gtgactccaccagagctgaccaaagatgacgagcgttacccgggccacgatccgcgctat
gcgaagctgaccgatgctgaactgccacagaccgaaagcctggcgctgaccatcgaccgc
gttgtgccttactggaacgaaaccattctgccacgcctgaaaagcggtgagcgcgttatc
atcgcagctcacggtaactccctgcgcgcgctggtgaaattcctggataacatgggtgaa
gacgagatcctcgaactgaacatcccaactggcgtgccgctggtatacgagttcgacgaa
aacttcaaaccaatcaaacactactatctgggtaacgctgacgaaatcgctgcaaaagcg
gcggccgtagcgaaccagggtaaagcgaagtaa

DBGET integrated database retrieval system