KEGG   Enterobacter asburiae LF7a: Entas_1240Help
Entry
Entas_1240        CDS       T01604                                 

Definition
(GenBank) Pectinesterase
  KO
K01051  pectinesterase [EC:3.1.1.11]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00040  Pentose and glucuronate interconversions
eas01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Entas_1240
Enzymes [BR:eas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Entas_1240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pectinesterase
Motif
Other DBs
NCBI-ProteinID: AEN63986
UniProt: G2S2V0
Position
complement(1351552..1352835)
Genome map
AA seq 427 aa AA seqDB search
MNISRISRLALALAFGVTLSACSSTPPDQQPSEQVAPGTASRPILSADEAKNFSQARYFT
AMDPNGAPWSPSSINLPKQPDFVVGPAGTQGVTHTSIQAAVDAAITKHSASRQYIAILPG
EYEGTVYVPAAPGSITLYGTGEKAIDVKIGLAIDSEIDSNTWRRLVNPAGKYMPGKPAWY
MFDNCQSKRTATVGVMCSAVFWSQNNGLQLQNLTIQNTLGDSVDAGTHQAVALRSDGDQV
QINNVNILGRQNTFFVTNSGVQNALVNNRLTRTLVTNSYVEGDVDLVSGRGAVVFDNTDF
RVVNSRTQQEGYVFAPATQSNLFYGFLAVNSRFTASGNGVAQLGRSLDVDSATNGQVVIR
DSVINEGFNTAKPWADAAVSKRPFSGNTGAVDDKGNVQRNLNDANFNRMWEYNNRGLGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatttccaggatttcccgtctggcgttagcactcgcctttggcgtgacattatcc
gcatgtagctcaacgccaccggaccagcagccttctgagcaggttgcaccgggcaccgca
tctcgtccgattctgtctgctgatgaagcgaaaaacttcagccaggcgcgttacttcacg
gcaatggacccaaatggggcaccgtggagcccgtcttcaatcaacctgcctaagcagcct
gatttcgtcgtcggcccggccggtacgcagggtgtcacgcacacctctattcaggcagcg
gttgacgcagcaatcactaaacacagcgcatcccgccagtacatcgcgatcctgccaggc
gaatacgaaggcactgtatacgtgcctgccgcgccgggcagcattaccctgtacggtacg
ggtgaaaaagccatcgacgtgaaaatcggtctggcgattgactccgaaatcgacagcaac
acctggcgtcgcctggtgaacccggccgggaaatatatgccgggcaaacctgcgtggtat
atgttcgataactgccagagcaaacgtaccgcaaccgtgggtgtgatgtgctctgcggta
ttctggtctcagaataacggtctccagttgcagaacttgaccattcaaaacaccctgggt
gatagcgtggacgccggtactcatcaggcggttgcactgcgcagcgatggcgatcaggtt
cagattaataacgtgaacattctgggtcgtcagaacaccttcttcgtgaccaacagcggt
gtgcagaacgcactggtgaacaatcgtctgacccgtactctggtcaccaatagctacgtt
gaaggcgatgtagacctcgtttccggccgtggcgcggtagtgtttgataatacggatttc
cgcgtagtgaattcccgtacacagcaagaaggttatgtgttcgcaccagcaacacagtcc
aacctgttctacggcttcctggcagtgaacagccgcttcaccgcgtccggtaatggcgtg
gcgcagttgggtcgctctctggatgtggattctgccaccaacggccaggttgttatccgc
gacagcgtgatcaacgaaggtttcaacacggcaaaaccgtgggcagacgccgcagtgtct
aagcgtccattctccggcaacaccggtgccgtggatgataaaggcaacgtgcagcgcaac
ctgaacgacgctaacttcaaccgcatgtgggaatacaacaaccgcggtctgggtagcaaa
gtggttgctgagcctaagcagtaa

DBGET integrated database retrieval system