KEGG   Enterobacter asburiae: Entas_1240Help
Entry
Entas_1240        CDS       T01604                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
eas  Enterobacter asburiae
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:eas00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eas00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1351552..1352835)
Genome map
AA seq 427 aa AA seqDB search
MNISRISRLALALAFGVTLSACSSTPPDQQPSEQVAPGTASRPILSADEAKNFSQARYFT
AMDPNGAPWSPSSINLPKQPDFVVGPAGTQGVTHTSIQAAVDAAITKHSASRQYIAILPG
EYEGTVYVPAAPGSITLYGTGEKAIDVKIGLAIDSEIDSNTWRRLVNPAGKYMPGKPAWY
MFDNCQSKRTATVGVMCSAVFWSQNNGLQLQNLTIQNTLGDSVDAGTHQAVALRSDGDQV
QINNVNILGRQNTFFVTNSGVQNALVNNRLTRTLVTNSYVEGDVDLVSGRGAVVFDNTDF
RVVNSRTQQEGYVFAPATQSNLFYGFLAVNSRFTASGNGVAQLGRSLDVDSATNGQVVIR
DSVINEGFNTAKPWADAAVSKRPFSGNTGAVDDKGNVQRNLNDANFNRMWEYNNRGLGSK
VVAEPKQ
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
ttgaacatttccaggatttcccgtctggcgttagcactcgcctttggcgtgacattatcc
gcatgtagctcaacgccaccggaccagcagccttctgagcaggttgcaccgggcaccgca
tctcgtccgattctgtctgctgatgaagcgaaaaacttcagccaggcgcgttacttcacg
gcaatggacccaaatggggcaccgtggagcccgtcttcaatcaacctgcctaagcagcct
gatttcgtcgtcggcccggccggtacgcagggtgtcacgcacacctctattcaggcagcg
gttgacgcagcaatcactaaacacagcgcatcccgccagtacatcgcgatcctgccaggc
gaatacgaaggcactgtatacgtgcctgccgcgccgggcagcattaccctgtacggtacg
ggtgaaaaagccatcgacgtgaaaatcggtctggcgattgactccgaaatcgacagcaac
acctggcgtcgcctggtgaacccggccgggaaatatatgccgggcaaacctgcgtggtat
atgttcgataactgccagagcaaacgtaccgcaaccgtgggtgtgatgtgctctgcggta
ttctggtctcagaataacggtctccagttgcagaacttgaccattcaaaacaccctgggt
gatagcgtggacgccggtactcatcaggcggttgcactgcgcagcgatggcgatcaggtt
cagattaataacgtgaacattctgggtcgtcagaacaccttcttcgtgaccaacagcggt
gtgcagaacgcactggtgaacaatcgtctgacccgtactctggtcaccaatagctacgtt
gaaggcgatgtagacctcgtttccggccgtggcgcggtagtgtttgataatacggatttc
cgcgtagtgaattcccgtacacagcaagaaggttatgtgttcgcaccagcaacacagtcc
aacctgttctacggcttcctggcagtgaacagccgcttcaccgcgtccggtaatggcgtg
gcgcagttgggtcgctctctggatgtggattctgccaccaacggccaggttgttatccgc
gacagcgtgatcaacgaaggtttcaacacggcaaaaccgtgggcagacgccgcagtgtct
aagcgtccattctccggcaacaccggtgccgtggatgataaaggcaacgtgcagcgcaac
ctgaacgacgctaacttcaaccgcatgtgggaatacaacaaccgcggtctgggtagcaaa
gtggttgctgagcctaagcagtaa

DBGET integrated database retrieval system