KEGG   Enterobacter asburiae LF7a: Entas_1518Help
Entry
Entas_1518        CDS       T01604                                 

Definition
glycoside hydrolase family protein
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Entas_1518
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Entas_1518
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1660050..1662110
Genome map
AA seq 686 aa AA seqDB search
MMNKFAPLSSKVAALLHGADYNPEQWENYPGIIEKDIAMMKQAKCNVMSVGIFSWAKLEP
REGEYDFAWLDTIIEKLYAAGIHIFLATPTGARPAWMSQKYPEVLRVGRNRVPALHGGRH
NHCMTSPVYRDKTLKINSLLAERYSQHPAVLGWHISNEYGGECHCNLCQERFRDWLKARY
KTLDALNHAWWSTFWSHTYTDWSQIESPSPQGEVSIHGLNLDWRRFNTAQVTDFCRHEVA
PLKAANAELPVTTNFMEYFYDYDYWQLAEAIDFISWDSYPMWHREKDETQLACYTAMYHD
MMRSLKGGKPFVLMESTPSTTNWQPTSKLKKPGMHILSSMQAVAHGADAVQYFQWRKSRG
SVEKFHGAIIDHVGHLDTRVGREVTRLGEMLERLPDVVGCRTEARVAIIFDQQNRWALDD
AEGPRNKGMEYEKTVNEHYRPFWEQGIAVDIIDADGDLSPYALVIAPMLYMVREGFAERA
EAFVAAGGHLVTTYWSGVVNETDLCHLGGFPGPLRKLVGIWAEEIDCLDDGERNLVQGLA
GNAAGLQGPYQVRHLCELIHAESAQVLATYRDDFYAGRPAVTVNRFGKGKAWHVASRNDL
PFQRDFFAAIINELALPRAIDGDFPPGVVATARTDGETTWAFVQNFTAQQQLITLPQGYT
DCMTDAVATGDTVLLAWDCRVLKRKA
NT seq 2061 nt NT seq  +upstreamnt  +downstreamnt
atgatgaataaatttgcgcctttaagttcaaaggtcgctgcgttattgcatggcgccgac
tataacccggagcaatgggagaattatcccggtattattgaaaaagatatcgccatgatg
aagcaggcgaaatgtaatgtcatgtcggtcgggatatttagctgggcgaaacttgaaccc
cgcgaaggggaatatgatttcgcctggctggacactattattgaaaagctttatgcggcg
ggtattcatattttcctggcgacgccaaccggcgcacgcccggcatggatgtcgcaaaaa
tacccggaagtgctgcgcgtggggcgcaaccgcgtgcctgcactgcatggcgggcgtcat
aaccactgcatgacgtctccggtgtatcgcgacaagacgctgaaaatcaacagcctgctg
gcggaacgctattcgcagcacccggcggtgctgggctggcatatttcgaatgaatacggt
ggggaatgccactgtaacctgtgtcaggaacgtttccgcgactggctgaaggcgcgctat
aaaaccctggatgccctgaaccatgcgtggtggagcaccttctggagccatacctacacc
gactggtcacagattgagtcaccgtcaccgcagggagaggtgtcgatccacggcctgaac
ctcgactggcgacgctttaatacggcgcaggtgaccgatttctgccgccatgaagtggcc
ccgctgaaagccgcgaatgcggaactgccggtgacgaccaacttcatggagtatttctac
gattacgactactggcagctggccgaagcgatcgactttatctcctgggacagctacccg
atgtggcacagggagaaagacgaaacgcagcttgcctgctacaccgccatgtatcacgac
atgatgcgcagcctgaagggcggcaaaccctttgtgttgatggagtccacgccgagcacc
accaactggcagccgaccagcaagctgaaaaaaccggggatgcatattctctcctcgatg
caggcggtggcccacggtgcggatgcagtgcagtacttccagtggcgcaagagccgtggg
tcggtggagaaattccacggggcgattatcgaccacgtgggtcacctggatacccgcgtc
ggacgggaagtgacgcgccttggcgaaatgcttgaacgtttgccggatgtcgtgggctgc
cgcactgaagcccgggtggcgattatcttcgaccagcaaaaccgctgggcgctggacgat
gccgaagggccgcggaacaagggaatggagtacgagaaaaccgttaacgagcactatcgc
ccattctgggagcagggtatcgcggtggatatcattgacgctgacggcgatctcagcccg
tacgcgctggtcatcgcgccaatgctttatatggtgcgtgaaggctttgccgaacgtgca
gaggcctttgtcgctgcgggcgggcatctggtgacgacctactggagcggagtggtgaat
gaaacggatctttgccatctgggcggtttcccggggccactgcgtaagctggtagggatc
tgggctgaggagattgattgtctggatgacggcgaacgtaacctggtccaggggctggcg
ggtaatgcggcagggttgcaggggccgtatcaggttcgtcatctgtgcgagctgatccac
gctgagtccgcgcaggtgctggcgacctaccgtgatgatttttacgctggtcggcctgcc
gtcacggtgaaccgctttggtaaaggtaaagcgtggcacgtggcatcgcgcaacgatttg
ccgttccagcgtgatttcttcgccgccattatcaacgagctggcgttgccacgggccatc
gacggcgacttcccgccgggtgtggtcgcaacagcgcgcacggacggtgaaaccacctgg
gcgtttgtgcagaactttaccgcccagcagcagcttattacgttgccgcaagggtatacc
gactgcatgacagacgccgttgctacgggcgatactgtgctgctggcgtgggactgccgg
gtgctgaagcgtaaagcgtag

DBGET integrated database retrieval system