KEGG   Enterobacter asburiae LF7a: Entas_1691Help
Entry
Entas_1691        CDS       T01604                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00010  Glycolysis / Gluconeogenesis
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_1691
Enzymes [BR:eas01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Entas_1691
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEN64432
UniProt: G2S9E4
Position
complement(1834440..1835324)
Genome map
AA seq 294 aa AA seqDB search
MINKIFALPVVEQLTPVLSHRKIDDADIIVIDHPRVKASVALNGAHLLSWKPEGEAEGLW
LSDITSFKKGAAIRGGVPICWPWFGPAAEQGLPAHGFARNQQWTLKAHNEDDNGAVLTFE
LHSNDETRKLWPHDFTLYARFKLGKTCEIELEAHGEFETSSALHTYFNVGDIGAVKVSGL
GDTFIDKVDNAKEGKLSDGVQTFPDRTDRVYLHPEACSVIHDTNLNRRIEVIHHHNSNVV
GWNPGPALSVSMGDVPDDGYKTFVCVETACVSPLQKASAEKPSRLAQTISIVKG
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgattaataaaatttttgcacttccggtagtcgaacaacttacccctgtgctctcccac
cgcaaaatcgatgatgccgatattatcgttattgatcacccacgcgttaaagcttcagtt
gcgctcaacggtgctcacctgctctcctggaaaccagaaggtgaagcagaaggtctgtgg
ctgagtgatattacctcgttcaaaaaaggcgcggcgatccgcggtggcgtaccgatctgc
tggccgtggtttggcccagcggcagaacaaggcctgcctgcgcacggttttgcccgcaat
caacagtggacgctgaaagcgcacaatgaagatgacaacggcgcggtgttgacctttgag
ctgcacagcaacgatgagactcgtaaactctggccacacgacttcacgctgtatgcgcgt
ttcaaactgggtaaaacctgtgaaattgagctggaagcccacggggaattcgaaacgtct
tctgccctgcacacctatttcaacgtaggtgatatcggtgcagtaaaagtcagcggcctt
ggcgataccttcatcgataaagtcgacaacgcgaaagaagggaaactgagcgatggcgtg
cagacgttcccggatcgtaccgaccgcgtttatctgcacccggaagcgtgcagcgtgatc
cacgatacaaacctcaatcgccggattgaggttatccaccaccacaatagcaacgttgta
ggctggaacccgggcccggcgctctctgtgagcatgggtgacgtgccggatgacggctat
aaaacctttgtctgtgtcgaaaccgcctgcgtttcacctctgcaaaaagccagtgccgag
aagccttctcgtctggcgcagaccattagcattgttaaaggctaa

DBGET integrated database retrieval system