KEGG   Enterobacter asburiae LF7a: Entas_1739Help
Entry
Entas_1739        CDS       T01604                                 

Definition
1-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entas_1739
   01230 Biosynthesis of amino acids
    Entas_1739
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_1739
   00030 Pentose phosphate pathway
    Entas_1739
   00051 Fructose and mannose metabolism
    Entas_1739
   00052 Galactose metabolism
    Entas_1739
  Energy metabolism
   00680 Methane metabolism
    Entas_1739
Enzymes [BR:eas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Entas_1739
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1880871..1881803)
Genome map
AA seq 310 aa AA seqDB search
MVSIYTLTLSPSLDSATLTPQIYPEGKLRCSAPVFEPGGGGINVARAITHLGGKATAIFP
AGGATGEHLVALLADEKVAVSTVNAQDWTRQNLHVHVTSSGEQYRFVMPGAKLSEDEFRQ
LEEKVLAIESGALLVISGSLPPGVKTERLTQLIRAVQKKGIRCIVDSSGEALQAALEPGQ
LELVKPNQKELSALVNRELTQPDDVRTAAQELIHSGKALRVVVSLGPQGALAVDGSGFVQ
VVPPPMKSQSTVGAGDSMVGAMALKLAQGASLLEMTRYGVAAGSAATINQGTRLCSLADT
LKIVDYLSRS
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atggtttctatttatacactcacgctctccccttccctcgactccgccaccctgacgccg
cagatttacccggaaggtaaactgcgctgtagcgcccctgtatttgaaccaggcggcggt
gggatcaacgtggcgcgcgccattacgcacctcggcggaaaggcgacggcaatattcccc
gccggcggcgctaccggggagcatctggtcgcactgctggcagatgaaaaggtcgcagtt
tcaaccgttaacgcccaggactggacgcggcagaacctgcacgtccacgtgacatccagc
ggcgaacagtaccgtttcgttatgcccggcgcgaaactgagcgaagatgaattccgccag
cttgaggaaaaagttctggccatcgagagtggtgccttgctggtcattagcggcagcctg
ccgcctggtgtcaaaacggaaaggctgacgcagttgatccgggccgtccagaagaagggg
atccgctgcattgttgacagctctggtgaagcacttcaggccgccttagagccagggcaa
cttgagctggtcaaacccaaccagaaagaactaagtgcgctggtcaaccgtgagctcacc
cagcctgacgatgtccgcactgcggcgcaagaactgattcacagcggcaaagccctgcgc
gtggtggtgtctcttggtccacaaggggcgttagccgttgatggctccggttttgtgcag
gtggtcccgccgccgatgaagagccagagcaccgtgggtgcaggcgacagcatggtgggt
gcaatggcgctgaaactggcgcaaggggcctcgttactggagatgacgcgctacggtgtg
gcggcaggtagcgcagcaacgattaaccagggtacacggttgtgttctcttgccgatacg
ctaaaaattgtggattacctttccagaagttaa

DBGET integrated database retrieval system