KEGG   Enterobacter asburiae LF7a: Entas_1751Help
Entry
Entas_1751        CDS       T01604                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Entas_1751
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Entas_1751
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Entas_1751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1892474..1893025
Genome map
AA seq 183 aa AA seqDB search
MQYDILNTEVTTIDGEKTTLEGYKGNVLLLVNVASKCGLTPQYEQLEALQKNWESEGFTV
LGFPCNQFLGQEPGSEEEIKTFCSTTYGVTFPLFSKIDVNGEHRHPLYEKLVSAAPTAVA
PQGSGFYERMASKGRAPLYPDDILWNFEKFLIGRDGQVIQRFSPDMTPEDTVVTDAIKKA
LAH
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgcagtacgatattctgaataccgaagtgaccaccattgacggcgaaaagacaacgctt
gagggctacaagggcaacgttttgctgctggtgaacgtggcctccaaatgtggcctgacg
ccacagtacgagcagcttgaagcgctgcaaaaaaactgggagagcgaaggctttaccgtg
cttgggttcccttgcaatcagtttttgggccaggagccgggcagcgaagaagagatcaaa
acattttgcagtaccacctatggtgtgaccttcccgctgttcagcaagattgatgtcaat
ggcgagcaccgtcatcctttgtatgaaaaactggtgtctgcggcaccgaccgcggttgcc
ccgcagggcagtggcttctacgagcgtatggccagtaaaggacgtgcgccgctctacccg
gacgatatcctgtggaactttgaaaaattcctgattgggcgtgacgggcaggttatacag
cgtttctctccggatatgacgccggaagacaccgtggtgactgacgcgattaaaaaggcg
ctggcgcactaa

  All links  
No link information was found.   
DBGET integrated database retrieval system