KEGG   Enterobacter asburiae LF7a: Entas_2206Help
Entry
Entas_2206        CDS       T01604                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Entas_2206
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_2206
  Lipid metabolism
   00071 Fatty acid degradation
    Entas_2206
  Amino acid metabolism
   00350 Tyrosine metabolism
    Entas_2206
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Entas_2206
   00626 Naphthalene degradation
    Entas_2206
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Entas_2206
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2384176..2385186
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQVNIAEKTLRPLQHGEALLTMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGIVKEIGPGVTSLKVGDRTSVAWFFEGCGHCEYCNTGNETLCRDVKNAGYSVDGGMAQE
CIVTADYAVKVPDGLDSAAASSITCAGVTTYKAVKISHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDEQLKLAASMGADLTVNSRSEDAAKVIQAKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIQVVGSLVGTRQDLLEAFQFAAEG
KVVPKVTMRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggctgctgttgtcacccacgatcatcaggtgaatatcgctgaaaaaaccctgcgt
ccgctgcaacatggcgaagcgctgttaacgatggaatgctgtggcgtttgccacaccgat
ctgcatgttaagaacggtgacttcggggataagaccggggttatcctgggccatgaaggg
attggcatcgtgaaagagattgggccgggcgtcacctcacttaaggttggcgatcggaca
agcgtggcgtggttcttcgaaggctgcggacattgtgaatactgtaataccggtaacgaa
accctgtgccgtgatgttaaaaacgccggttattccgtagacggcggcatggcgcaggag
tgcatcgtgaccgccgattacgcggtaaaagtcccggatggtctcgactctgccgccgcc
agcagcattacctgtgctggggttaccacctataaagctgtgaaaatttcccatatcaaa
cccggccagtggattgcgatttacggcctcggtgggctgggtaaccttgcgctgcaatac
gccaaaaacgtgttcaatgccaaagttattgccattgacgttaatgacgaacagctgaaa
ttagcggccagtatgggtgctgatttgaccgtgaactcccgaagcgaagatgccgcaaag
gttatccaggccaaaactggtggcgcacatgccgcagtggtcaccgcagtagcaaaagca
gcgtttaactctgcggtggatgcggttcgcgcaggtggccgcgtggtcgccgtcggcctg
ccgccggaagccatgagcctggacattccacgtctggtgctggacggtattcaggttgtg
gggtcgcttgtcggtacgcgtcaggatctgctggaggcgttccagtttgccgccgaaggt
aaagttgttccgaaagtaacaatgcgtccgctagaagatatcaacgctatcttcaaagag
atggaacaagggcaaatccgtggccggatggttattgatttacgttcgtaa

DBGET integrated database retrieval system