KEGG   Enterobacter asburiae LF7a: Entas_2379Help
Entry
Entas_2379        CDS       T01604                                 

Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Entas_2379
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entas_2379
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Entas_2379
Enzymes [BR:eas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Entas_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2568566..2569375
Genome map
AA seq 269 aa AA seqDB search
MERYDNAFAQLKARKEGAFVPFVTLGDPGPEQSLKIIDTLVEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPTQCFEMLAAIRQKHPTIPIGLLMYANLVFNRGIDEFYAECAR
VGVDSVLVADVPIEESAPFRQAAMRHNVAPIFICPPNADDELLRQIASYGRGYTYLLSRA
GVTGAENKAALPLHHLVEKLAQYHAAPPLQGFGISSPEQVTAAIDAQAAGAISGSAIVKI
IEKNVDKPEQMLAELKAFVTAMKAATRKA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgataacgcatttgcacaactgaaagcccgcaaggaaggcgcgttcgtt
cccttcgtcacccttggcgatcctggcccggagcagtcgctgaaaatcatcgataccctg
gttgaagccggtgccgatgcgctggagctgggtatcccgttctcagacccgctggcagat
ggtccaaccattcagaatgcgaccctgcgcgcctttgcggctggcgtaacgccaacccag
tgtttcgagatgctggcagccattcgtcagaaacacccgaccatcccgattggcctgctg
atgtatgccaacctggtgtttaaccgcggtattgatgagttctatgccgaatgtgcccgc
gtgggcgttgattccgtactggttgcggatgtgccgattgaagagtctgccccgttccgc
caggcagcgatgcgtcataacgttgcgccgattttcatctgcccgccaaatgccgatgac
gaactgctgcgccagattgcctcttacggccgtggttacacctacctgctttcccgtgcg
ggtgtgacaggcgccgagaacaaagcggcgctgccactgcatcatctggtggaaaaactg
gcgcaataccacgcagcgcctccgctgcaaggctttggtatctcctcgccagagcaggtt
actgcggcgattgacgcccaggctgccggggcgatttcaggctccgcaattgtgaaaatc
atcgagaagaacgttgataagccagagcagatgctggccgaactgaaagccttcgtgacc
gcgatgaaagccgctacacgtaaagcgtaa

DBGET integrated database retrieval system