KEGG   Enterobacter asburiae LF7a: Entas_2379Help
Entry
Entas_2379        CDS       T01604                                 

Definition
(GenBank) Tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Entas_2379
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Entas_2379
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Entas_2379
Enzymes [BR:eas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Entas_2379
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2568566..2569375
Genome map
AA seq 269 aa AA seqDB search
MERYDNAFAQLKARKEGAFVPFVTLGDPGPEQSLKIIDTLVEAGADALELGIPFSDPLAD
GPTIQNATLRAFAAGVTPTQCFEMLAAIRQKHPTIPIGLLMYANLVFNRGIDEFYAECAR
VGVDSVLVADVPIEESAPFRQAAMRHNVAPIFICPPNADDELLRQIASYGRGYTYLLSRA
GVTGAENKAALPLHHLVEKLAQYHAAPPLQGFGISSPEQVTAAIDAQAAGAISGSAIVKI
IEKNVDKPEQMLAELKAFVTAMKAATRKA
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctacgataacgcatttgcacaactgaaagcccgcaaggaaggcgcgttcgtt
cccttcgtcacccttggcgatcctggcccggagcagtcgctgaaaatcatcgataccctg
gttgaagccggtgccgatgcgctggagctgggtatcccgttctcagacccgctggcagat
ggtccaaccattcagaatgcgaccctgcgcgcctttgcggctggcgtaacgccaacccag
tgtttcgagatgctggcagccattcgtcagaaacacccgaccatcccgattggcctgctg
atgtatgccaacctggtgtttaaccgcggtattgatgagttctatgccgaatgtgcccgc
gtgggcgttgattccgtactggttgcggatgtgccgattgaagagtctgccccgttccgc
caggcagcgatgcgtcataacgttgcgccgattttcatctgcccgccaaatgccgatgac
gaactgctgcgccagattgcctcttacggccgtggttacacctacctgctttcccgtgcg
ggtgtgacaggcgccgagaacaaagcggcgctgccactgcatcatctggtggaaaaactg
gcgcaataccacgcagcgcctccgctgcaaggctttggtatctcctcgccagagcaggtt
actgcggcgattgacgcccaggctgccggggcgatttcaggctccgcaattgtgaaaatc
atcgagaagaacgttgataagccagagcagatgctggccgaactgaaagccttcgtgacc
gcgatgaaagccgctacacgtaaagcgtaa

DBGET integrated database retrieval system