KEGG   Enterobacter asburiae LF7a: Entas_2409Help
Entry
Entas_2409        CDS       T01604                                 

Definition
iron-containing alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Entas_2409
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_2409
   00620 Pyruvate metabolism
    Entas_2409
   00650 Butanoate metabolism
    Entas_2409
  Lipid metabolism
   00071 Fatty acid degradation
    Entas_2409
  Amino acid metabolism
   00350 Tyrosine metabolism
    Entas_2409
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Entas_2409
   00626 Naphthalene degradation
    Entas_2409
Enzymes [BR:eas01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Entas_2409
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Entas_2409
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2592495..2595176
Genome map
AA seq 893 aa AA seqDB search
MAVTNIAELNALVERVKKAQREYANFTQEQVDKIFRAAALAAADARIPLAKMAVAESGMG
IIEDKVIKNHFASEYIYNAYKDEKTCGVLSEDDTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLISLKTRNAIIFSPHPRAKDATNKAADIVLQAAIAAGAPKDLIGWIDQPSVELSNA
LMHHPDINLILATGGPGMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASVLMSKTF
DNGVICASEQSVVVVDSVYDAVRERFASHGGYMLQGKELKAVQDIILKNGALNAAIVGQP
AYKIAELAGFTVPASTKILIGEVKVVDESEPFAHEKLSPTLAMYRAKDFEDAVEKAEKLV
AMGGIGHTSCLYTDQDNQPERVAHFGQMMKTARILINTPASQGGIGDLYNFKLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALDEVITDGHK
RALIVTDRFLFNNGYADQITSVLKAAGVETEVFFEVEADPTLSVVRKGAELANSFKPDVI
IALGGGSPMDAAKIMWVMYEHPETHFEELALRFMDIRKRIYKFPKMGVKAKMIAVTTTSG
TGSEVTPFAVVTDDATGQKYPLADYALTPDMAIVDANLVMDMPKSLCAFGGLDAVTHALE
AYVSVLASEFSDGQALQALKLLKENLPASYNEGSKNPVARERVHSAATIAGIAFANAFLG
VCHSMAHKLGSQFHIPHGLANALLISNVIRYNANDNPTKQTAFSQYDRPQARRRYAEIAD
HLGLSAAGDRTAAKIEKLLAWLESIKAELGIPKSIREAGVQEADFLAHVDKLSEDAFDDQ
CTGANPRYPLISELKQILLDTYYGREFKEGEVAAAKVEAAPAAKADKKAKKSA
NT seq 2682 nt NT seq  +upstreamnt  +downstreamnt
atggctgttactaacatcgctgaactgaacgcactcgtcgagcgcgtcaaaaaagcccag
cgtgaatatgccaatttcacccaagaacaggttgataaaatcttccgcgcggccgctctg
gctgctgcagatgctcgaatccctctcgctaaaatggccgttgctgaatctggcatgggt
atcatcgaagataaagtgatcaaaaaccactttgcttctgagtatatctacaacgcctat
aaagatgagaaaacctgtggcgttctgtctgaagacgacaccttcggtactatcactatc
gctgaacctatcggcattatttgcggtatcgttccaaccaccaacccaacttctaccgca
atcttcaaatcactgatcagcctgaagacccgtaacgcaatcatcttctccccgcaccca
cgtgctaaagatgcaaccaacaaagctgctgatatcgtattgcaggcggctatcgctgcg
ggcgcaccaaaagacctgatcggctggattgaccaaccttctgttgaactgtccaacgcg
ctgatgcatcaccctgacattaacctgatcctggcgaccggtggtcctggtatggttaaa
gcagcatacagctccggtaaaccagccatcggcgtaggcgcgggtaacacccctgtcgtt
atcgacgaaactgcggatatcaaacgtgctgttgcttctgtactgatgtctaaaaccttc
gataacggcgtaatctgtgcgtctgagcagtccgttgttgttgttgattctgtatacgat
gcggttcgtgaacgtttcgcaagccacggcggctacatgctgcaaggcaaagagctgaaa
gccgttcaggacatcatcctgaaaaatggcgcgctgaacgccgctatcgttggccagcca
gcgtataaaatcgctgaactcgcaggtttcaccgttccggctagcactaagatcctgatc
ggtgaagtaaaagttgttgatgagagcgaaccatttgctcacgaaaaactgtcacctacg
cttgcaatgtaccgcgcgaaagatttcgaagacgcggtagaaaaagccgagaaactggtt
gccatgggtggtatcggccacacctcatgtctgtacaccgaccaggataaccagccagaa
cgtgttgctcacttcggtcagatgatgaaaacagcacgtatcctgattaacacccctgct
tctcagggtggtatcggtgacctgtacaactttaaactcgcaccttccctgactctgggt
tgtggttcctggggtggtaactccatctctgaaaacgttggtccaaaacacctgatcaac
aagaaaaccgttgctaagcgagctgaaaacatgttgtggcacaaacttccgaaatctatc
tacttccgccgtggctccctgccaatcgcgctggatgaagtgattactgatggccacaaa
cgtgcgctcatcgtgaccgaccgtttcctgttcaacaacggctatgcagaccagatcacc
tctgttctgaaagctgctggcgtcgaaactgaagtcttcttcgaagttgaagctgaccca
acactgagcgttgttcgcaaaggtgctgaactggcgaactccttcaaaccagatgtgatc
atcgcactgggtggcggttccccaatggacgccgcgaaaatcatgtgggtaatgtacgag
cacccagaaacgcacttcgaagaactggcgctgcgctttatggatatccgtaaacgtatc
tacaagttcccgaaaatgggcgtaaaagcgaaaatgatcgctgtgacgaccacttccggt
accggttcagaagtgacgccgtttgcggttgttaccgacgatgcaacaggtcagaaatac
ccactggctgactatgcactgactccagatatggccattgttgacgccaacctggtaatg
gatatgccgaagtcactgtgtgcattcggtggtctggatgcagtgactcacgccctggaa
gcttacgtttctgtactggcatctgagttctctgacggccaggctctgcaagcgctgaaa
ctgctgaaagaaaacctgcctgcgtcctacaacgaagggtctaaaaaccctgtagcacgt
gagcgtgtacacagtgcagcaactatcgcgggtatcgcgtttgctaacgccttcctgggt
gtttgtcactcaatggcgcacaaactgggttctcagttccacattcctcacggtctggcg
aacgccctgttgatcagcaacgttatccgttataacgcgaacgacaacccaaccaaacag
actgcattcagccagtacgaccgcccacaagcacgtcgtcgttacgctgaaatcgcagac
catctgggtctgagcgctgcgggtgaccgtactgctgcgaagattgagaaactgctggca
tggctggaaagcatcaaagctgaactgggtattcctaaatctatccgtgaagctggcgtt
caggaagctgacttcctcgctcacgtagataaactgtctgaagatgccttcgatgaccag
tgtactggtgctaacccgcgctacccactgatctccgagctgaaacagatcctgctggat
acctactacggccgtgagttcaaagaaggtgaagttgcagcagctaaagttgaagcagct
cctgcggcaaaagctgacaaaaaagcgaagaaaagtgcttaa

DBGET integrated database retrieval system