KEGG   Enterobacter asburiae LF7a: Entas_2412Help
Entry
Entas_2412        CDS       T01604                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Entas_2412
   00052 Galactose metabolism
    Entas_2412
   00500 Starch and sucrose metabolism
    Entas_2412
   00520 Amino sugar and nucleotide sugar metabolism
    Entas_2412
Enzymes [BR:eas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Entas_2412
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2597041..2597949)
Genome map
AA seq 302 aa AA seqDB search
MAALNSKVRKAVIPVAGLGTRMLPATKAIPKEMLPLVDKPLIQYVVNECIAAGITEIVLV
THSSKNSIENHFDTSFELEAMLEKRVKRQLLAEVQSICPPHVTIMQVRQGLAKGLGHAVL
CAHPVVGDEPVAVILPDVILDEFESDLSQDNLAEMIKRFDETGSSQIMVEPVADVTAYGV
VDCKGVNLEPGESVPMVGVVEKPKADVAPSNLAVVGRYVLSAEIWPLLAKTPPGAGDEIQ
LTDGIDMLIEKETVEAYHMKGKSHDCGNKLGYMQAFVEYGIRHNTLGEEFKSWLQESMGI
KK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atggctgccctaaattcgaaagtcagaaaggccgttatcccggtagcgggattgggaacc
aggatgctacccgcaacgaaggcaatccctaaagagatgctgccgttggttgataagcca
ttaatccagtatgtcgttaatgaatgtatcgctgccggaattaccgaaattgtgctggtt
acgcattcatccaaaaactctatcgaaaaccatttcgatacaagttttgaacttgaagcc
atgctggaaaaacgcgttaagcgtcagctgttagcggaagttcagtctatttgcccaccg
catgtcaccatcatgcaggtgcgtcagggtctggcgaaaggcctgggccatgcggtgctg
tgtgctcaccctgtcgtgggtgacgagccagtggccgttattctgccagacgttattctg
gatgaattcgaatccgatttgtcccaggataacctggcagagatgattaaacgcttcgat
gaaaccggcagcagccagatcatggttgagcctgttgcggatgtcaccgcatacggcgtt
gtagactgcaaaggcgttaacctggagcctggcgaaagcgtgccgatggttggtgtcgtt
gaaaagccaaaagcggatgttgcaccgtctaatctggccgttgtgggtcgttacgtcctg
agcgcagaaatctggccgctgctggccaaaacccctccaggagcgggtgatgagatccag
ctaactgatggcattgatatgctgatcgagaaagaaaccgttgaagcttaccacatgaaa
ggtaagagccatgactgcggtaataaactcggttatatgcaggcgtttgttgaatatggc
attcgccacaatactctgggtgaagaatttaaatcctggctccaggagagcatgggtatt
aaaaaataa

DBGET integrated database retrieval system