KEGG   Enterobacter asburiae: Entas_2568Help
Entry
Entas_2568        CDS       T01604                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eas  Enterobacter asburiae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eas03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2766502..2767113)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLLEAGGVGYEVHMPMTCFYELPDAGKEAIVFTQFVVREDAQLL
YGFNNKQERTLFRELIKTNGVGPKLALAILSGMSAQQFVNAVEREDPVALIKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPGAPTADDAEQEAVAALVALGYKPQEASRM
VSKIAKPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgttagtgctgctcgaa
gcgggaggcgtaggctatgaagtccatatgccaatgacctgtttctatgaacttcctgac
gcgggcaaagaagcgattgtcttcacccagttcgttgtgcgtgaagatgcgcagctgctg
tatggttttaataacaagcaggaacgcaccctgttccgcgagctgattaaaaccaacggc
gtcgggccaaaactggcactggcgattttatccggcatgtctgcacagcagtttgtgaat
gccgtcgagcgcgaagatccggtcgcgctgattaaactgcctggcatcggcaagaagacc
gcagagcgcctgattgtggaaatgaaagaccgctttaaaggcctgcacggcgatctgttt
acgccagcggcagacctggtgttgacatcgccgggtgcgccaacggctgatgatgctgag
caggaagcggttgctgctctggtagcgctgggctataaacctcaggaggccagccgtatg
gtgagcaaaatcgccaaaccggatgccagcagtgaaaccctgattcgtgaagcgctgcgc
gctgcattgtga

DBGET integrated database retrieval system