KEGG   Enterobacter asburiae LF7a: Entas_2568Help
Entry
Entas_2568        CDS       T01604                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Entas_2568
Enzymes [BR:eas01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Entas_2568
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2766502..2767113)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIIIEKQPPLVLLEAGGVGYEVHMPMTCFYELPDAGKEAIVFTQFVVREDAQLL
YGFNNKQERTLFRELIKTNGVGPKLALAILSGMSAQQFVNAVEREDPVALIKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPAADLVLTSPGAPTADDAEQEAVAALVALGYKPQEASRM
VSKIAKPDASSETLIREALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcatcatcattgaaaaacaacccccgttagtgctgctcgaa
gcgggaggcgtaggctatgaagtccatatgccaatgacctgtttctatgaacttcctgac
gcgggcaaagaagcgattgtcttcacccagttcgttgtgcgtgaagatgcgcagctgctg
tatggttttaataacaagcaggaacgcaccctgttccgcgagctgattaaaaccaacggc
gtcgggccaaaactggcactggcgattttatccggcatgtctgcacagcagtttgtgaat
gccgtcgagcgcgaagatccggtcgcgctgattaaactgcctggcatcggcaagaagacc
gcagagcgcctgattgtggaaatgaaagaccgctttaaaggcctgcacggcgatctgttt
acgccagcggcagacctggtgttgacatcgccgggtgcgccaacggctgatgatgctgag
caggaagcggttgctgctctggtagcgctgggctataaacctcaggaggccagccgtatg
gtgagcaaaatcgccaaaccggatgccagcagtgaaaccctgattcgtgaagcgctgcgc
gctgcattgtga

DBGET integrated database retrieval system