KEGG   Enterobacter asburiae: Entas_2809Help
Entry
Entas_2809        CDS       T01604                                 

Definition
regulatory protein GalF
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
eas  Enterobacter asburiae
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:eas00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:eas00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eas00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:eas00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2993526..2994425)
Genome map
AA seq 299 aa AA seqDB search
MINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIILDTATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLESEGQVSRIVEFIEKPDQPQTLDSDLMAVGRYVLNADIWAELEKTAPGAWDRVQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVNYGMRNLKEGQKFRESIKKLLETHD
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgattaatttgaaagcagtcattccggtggcgggcctgggtatgcatatgctgccagcc
acgaaggcaattcctaaagagatgctgccaatcgttgataagccaatgattcagtacatc
gttgacgaaattgttgccgcagggatcaaagaaatcgttctggtgacgcactcatccaag
aatgcggtagaaaaccacttcgacacctcttacgaactcgaagcgctgcttgagcagcgc
gtgaagcgccagctgctggccgaagttcagtcgatctgtcctcctggcgtgaccatcatg
aacgttcgtcaggcgcagccactgggtctgggtcactccattctttgtgctcgccctgtt
gtgggtgacaatccatttattgttgtactgccagacatcattctggacaccgcaaccgcc
gatccgctgcgttacaacctcgccgctatggttgcgcgtttcaatgaaaccggccgcagt
caggttctggcgaagcgcatgaagggcgatctgtctgaatactccgtcattcagaccaaa
gaacctctggaatccgaaggtcaggtgagccgtattgttgagtttatcgagaaaccggat
caaccacagacgctggactccgatctgatggccgttggccgctatgttctgaacgctgac
atttgggccgagctcgagaagactgctcctggtgcctgggatcgtgttcagctgactgac
gccattgcagagctggcgaagaaacagtccgttgacgccatgctgatgaccggcgacagc
tacgactgtggtaagaaaatgggttacatgcaggcgtttgtgaactacggaatgcgcaac
ctgaaagaagggcagaagttccgcgagagcattaagaagctgctagaaacgcatgactaa

DBGET integrated database retrieval system