KEGG   Enterobacter asburiae: Entas_2901Help
Entry
Entas_2901        CDS       T01604                                 

Definition
glycoside hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
eas  Enterobacter asburiae
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:eas00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3106565..3107959)
Genome map
AA seq 464 aa AA seqDB search
MKTFPDDFLWGGAVAANQVEGAYLTDGKGLSTSDVQPQGVFGPVVERVAGDNGIKDVAID
FYHRYPEDIALFAEMGFSCLRVSIAWTRIFPNGDEQQPNEAGLAFYDKLFDELAAHNITP
LVTLSHYEMPWGLVKQYGGWGSRQVIGFFERYARTVFARYKEKVKLWLTFNEINMSLHAP
MTGVGLPETSSKGEVYQAIHHQLVASALAVKACHDIIPDARIGNMLLGGLMYPLTCKPED
VLEALQENRAWQFFGDVQCRGAYPGYMLRFFRDNGIQLEMTDADRDALKSTIDFISFSYY
MTGCVTTDEALNQQARGNILSMVPNPHLASSEWGWQIDPVGLRTLLNVLWDRYQKPLFIV
ENGLGAKDKPDADGVVQDDYRISYLNDHLVQVREAIDDGVEVMGYTSWGPIDLVSASKAE
LSKRYGFIYVDRDDSGNGTLARSRKKSFHWYKEVIATKGASLKV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgaaaactttcccggatgattttttatggggcggcgcggttgccgcgaatcaggtagaa
ggcgcttacctgaccgatggcaaagggttatccacctctgacgtccagccgcagggggtg
tttggcccggtggtcgagcgtgtggcgggtgacaacggcattaaagatgtggcgattgat
ttctatcaccgctatccggaagacatcgccctgtttgccgagatgggcttcagctgcctg
cgtgtctcgattgcctggacgcgtatcttcccgaacggggatgaacaacagccaaacgaa
gcgggcctggcgttttacgacaagctgttcgacgaactggctgcacacaacatcacgccg
ctggtgactctgtcgcactatgaaatgccgtggggactggtgaagcagtatggtggctgg
ggcagccgtcaggtgattggtttcttcgagcgttacgcccgcaccgtgtttgcgcgttac
aaagagaaagtcaaactgtggctgaccttcaacgagatcaacatgtcgctgcacgcgccg
atgaccggtgttggcctgccggaaaccagcagtaaaggcgaggtgtatcaggcaatccac
catcagctggtggccagcgcgctggcggtaaaagcctgccatgacattatccctgacgcc
agaattggcaacatgctgctgggcggcctgatgtatccgctgacctgtaagccagaagat
gtgctggaagcgcttcaggaaaaccgcgcctggcagttctttggcgacgtgcagtgccgt
ggcgcctatccgggctacatgctgcggttcttccgtgataatggcattcagctggagatg
accgatgccgatcgcgatgcgctgaaatcgaccatcgatttcatctccttcagctattac
atgaccggctgtgtgaccaccgatgaagcgctgaaccagcaggcgcgcggtaatatcctg
agcatggtgccgaacccgcaccttgcaagctctgaatggggctggcagattgacccggtt
ggcctgcgcaccctgctgaacgtgctgtgggatcgctatcagaaaccgctgtttatcgtg
gaaaacggtctgggtgcgaaagataagccggatgccgacggcgtggtgcaggacgactac
cgtatcagctatctcaacgatcacctggttcaggtgcgagaagcgattgacgacggcgtt
gaggtaatgggctataccagctgggggccaattgacctggtcagtgcctcgaaagcggaa
ctgtctaaacgttacggctttatttatgtcgaccgtgacgatagtggaaacgggacgctg
gcgcgcagccgtaagaaaagtttccactggtataaagaagtgattgccacaaaaggcgcg
tcactgaaagtgtaa

DBGET integrated database retrieval system