KEGG   Enterobacter asburiae: Entas_2920Help
Entry
Entas_2920        CDS       T01604                                 

Definition
GTP cyclohydrolase 1
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
eas  Enterobacter asburiae
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:eas00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3127166..3127834)
Genome map
AA seq 222 aa AA seqDB search
MSSLSKEAALVHEALLARGLETPLRPPVQEMDNETRKRLISGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFSGLDYANFPKITVIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDTVIGLSKINRIVRFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGVRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcatcactcagtaaagaagctgccctggttcatgaagccctgcttgcgcgcggcctt
gaaacgcctctgcgtccacccgttcaggagatggacaatgaaacacgtaaacgtctgatt
tctggccatatgaccgagattatgcaattgctgaatctcgatctgagcgatgacagcctg
atggaaacccctcaccgcatcgcgaaaatgtatgtcgatgagatcttctcaggtctggac
tacgctaacttcccgaaaatcaccgttatcgaaaataagatgaaggttgatgagatggta
acggttcgcgacattacgctgaccagcacctgcgagcatcacttcgtcaccatcgacggt
aaagccaccgtggcctacattccgaaagatacggtgattggtctgtccaaaatcaaccgt
atcgtgcgcttctttgcccagcgtccgcaggtacaggagcgtctgacgcaacagatcctg
actgcgctgcaaacgctgctggggaccaataacgtggcggtgtctatcgatgcggttcac
tactgtgtgaaagcacgcggcgttcgcgatgcaaccagcgcgaccacgaccacgtctctg
ggtggcctgtttaaatccagccagaacactcgccaggagttcctgcgcgcggtgcgtcac
cacaactaa

DBGET integrated database retrieval system