KEGG   Enterobacter asburiae LF7a: Entas_3127Help
Entry
Entas_3127        CDS       T01604                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00010  Glycolysis / Gluconeogenesis
eas00052  Galactose metabolism
eas00500  Starch and sucrose metabolism
eas00520  Amino sugar and nucleotide sugar metabolism
eas00521  Streptomycin biosynthesis
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
eas01200  Carbon metabolism
Module
eas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
eas_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_3127
   00052 Galactose metabolism
    Entas_3127
   00500 Starch and sucrose metabolism
    Entas_3127
   00520 Amino sugar and nucleotide sugar metabolism
    Entas_3127
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Entas_3127
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Entas_3127
Enzymes [BR:eas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Entas_3127
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase PaaX_C
Motif
Other DBs
NCBI-ProteinID: AEN65850
UniProt: G2S3B6
Position
complement(3338936..3339901)
Genome map
AA seq 321 aa AA seqDB search
MTKYALVGDVGGTNARLALCDVNTGEISQAKTYSGLDYPSLEAVVRVYLDEHKISVEDGC
IAIACPITGDWVAMTNHTWAFSIAEMKKNLGFSHLEIINDFTAVSMAIPMLKPEHLIQFG
GTAPVEGKPIAVYGAGTGLGVSHLVHVDKRWVSLPGEGGHVDFAPNSEEEGIILEELRAE
IGHVSAERVLSGPGLVNLYRAIVKSDGRLPENLQPKDVTERALADTCIDCRRALSLFCVI
MGRFGGNLALNLSTFGGVFIAGGIVPRFLDFFKASGFRGGFEDKGRFRSYVQDIPVYLIV
HDNPGLLGSGAHLRQVLGQVL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atgacaaagtatgctttagtaggtgacgtgggtgggactaacgcacgtcttgccctctgc
gatgtaaacaccggtgagatttctcaggcgaagacctattcagggctggattatccaagc
cttgaggccgtggttcgcgtctatcttgatgagcataagataagtgttgaggacggttgt
attgctattgcctgcccgattaccggcgactgggtagccatgaccaaccatacctgggca
ttctctatcgcagaaatgaaaaaaaacctcggtttttcgcatcttgaaatcattaatgac
tttactgcggtgtcgatggcgatcccgatgttaaagccagaacacctgattcagtttggt
ggcaccgccccagtcgaaggcaaaccgattgccgtttatggcgcaggcaccggtctgggg
gtgtcacatctggtgcacgttgataaacgctgggtcagcctgccgggcgagggtggccac
gttgattttgcgccaaacagcgaagaagagggaattattctcgaagagttgcgtgcagag
attggccatgtgtccgctgagcgtgtgctttccggtccggggctggtgaatctctatcgc
gcgattgtgaagtctgacggtcgtctgcctgaaaacctgcaaccgaaagacgtcaccgaa
cgcgcgctggcagacacctgcatcgactgtcgtcgtgcgctgtcgctgttctgcgtcatc
atggggcgttttggcggcaacctggcgctgaacctcagcaccttcggcggcgtgtttatc
gcaggcggcatcgtgcctcgtttccttgatttctttaaagcctctggtttccgtggtgga
tttgaggataaaggtcgtttcagaagctacgttcaggacattccggtgtacctgattgtg
cacgataacccgggcctgctgggctctggtgcgcacttgcgtcaggttctcggccaggtg
ctgtaa

DBGET integrated database retrieval system