KEGG   Enterobacter asburiae LF7a: Entas_3169Help
Entry
Entas_3169        CDS       T01604                                 

Definition
glycoside hydrolase family protein
Orthology
K12111  
evolved beta-galactosidase subunit alpha [EC:3.2.1.23]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Galactose metabolism
Other glycan degradation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Entas_3169
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Entas_3169
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Entas_3169
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3384860..3387943
Genome map
AA seq 1027 aa AA seqDB search
MNRWENIQLTHENRLAPRAYFFSYDDVAQARTFAREASSHFLSLSGQWNFRFFTNPLLVP
ENFTSEYMANWGAITVPAMWQMEGHGNLQYTDEGFPFPVDVPWVPTDNPTGAYQRFFTLS
DGWQDKQTLIKFDGVETYFEVYVNGRYIGFSKGSRLTAEFDISDAVVTGQNLLCVRVMQW
ADSTYIEDQDMWWTAGIFRDVYLVGKNPAHVQDFTVKTTFDEDYQDATLSCQLALENLAM
QPVNVTLEYTLYDGDVVLHQGSTRSLTLTRTEETGFSIAVKQPHQWSAESPYLYHLVITL
KDEQGQTLEVIPQRIGFRDIAVRNGLFYVNNHYLKLHGVNRHDNDHQKGRAVGMDRVERD
IVLMKQHNINSVRTAHYPNDPRFYELCDIYGLFVMAETDVESHGFANVGDLSRITDDPVW
EHVYVERIVRHIHAQKNHPSIIIWSLGNESGYGCNIRAMARAAKALDDTRLLHYEEDRDA
EVVDIISTMYTRVPLMNLFGEYPHPKPRIICEYAHAMGNGPGGLTEYQNVFDRHDCIQGH
YVWEWCDHGIQTTDASGRTFYAYGGDFGDYPNNYNFCLDGLIYSDQTPGPGLREYKQVIA
PVKLAWHNSALRVENKLWFTTLDDYSLHLEVRAEGETLHSQQLSLAGITPNSTHTLAVAL
PELDEREAFLTAHVRKNSRTLYSEAGHEIATYQFPLKARTASATPFIDRNATPLKLEEDR
LSCTVTGHNFRVSFSKLTGKLSAWQVNGEEKLTRDPKINFFKPMIDNHKQEFEGLWQPNH
LHILQEHLRGFETEACDSEVVITTRTLIAPPVFDFGMRCTYRWRVAADGQINVELSGERY
GDYPHIIPCIGVTLGINGAFDQVTYYGRGPGENYPDSQQASTIDLWHTTVDEMFENYPLP
QNNGNRQQVRWASLANRQGSGVLVVPEQPIHFSAWHYTPENIHAAQHCNELQRSDDITLN
LDHQLLGLGSNSWGSEVLDSWRVWFRPFSYGFTLLPLEGGQSASRILAQHQFGAGFFSTN
SHSEADQ
NT seq 3084 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgctgggaaaatattcaactcacgcatgagaaccggcttgccccgcgtgcgtac
ttcttttcgtatgacgatgttgcgcaggcgcgcacctttgcccgtgaagccagcagccac
tttttgtccttaagcggccagtggaattttcgctttttcaccaacccgttgctggtacct
gaaaactttacctctgaatatatggccaactggggcgcgataactgtgccagccatgtgg
cagatggaaggccacggtaatcttcaatataccgatgaaggtttccccttcccggttgat
gtgccctgggtgcccaccgataacccgaccggcgcgtatcagcgctttttcaccctgtct
gacggctggcaggacaaacagaccctgattaaatttgacggcgtagaaacctatttcgag
gtttacgttaatggccgttatatcggctttagcaaaggtagccggctgaccgccgagttc
gacatcagcgatgcggtggtgaccgggcaaaacctgctgtgcgtgcgcgtcatgcagtgg
gctgactcaacctacattgaagatcaggatatgtggtggacggcgggcattttccgcgac
gtctatctggtcggcaaaaatccggcacacgtgcaggacttcacggtcaaaacgacgttt
gatgaagactaccaggatgcaaccctctcctgccagcttgcgctggaaaacctcgccatg
cagccggttaatgtgacgctggaatataccctctatgacggtgatgtggtcttgcatcag
ggctcaacccgcagccttacgctcacccgcacagaggaaaccgggtttagcatcgcggtt
aagcagccgcatcagtggtcagcggaatcaccctacctgtatcacctggtgatcacgctg
aaagatgagcaggggcaaacgctggaagtgatccctcagcgcatcggttttcgtgatatc
gccgtgcgaaatggcctgttttacgtcaacaaccactacctgaagctgcacggcgtcaac
cgccacgacaacgatcatcagaaaggccgcgccgtggggatggatcgcgtcgagcgcgat
atcgtcctgatgaagcagcacaacatcaactcggtgcgaaccgcccactacccgaacgat
cctcgcttctatgagctgtgcgatatctacggcctgttcgtcatggcagaaacggatgtt
gaatcccacggttttgccaacgtaggtgatttgagccgcatcactgacgatccggtatgg
gagcatgtttacgtcgagcgcatcgtgcgccacattcacgcccagaaaaaccatccgtcc
atcatcatctggtcgctcggcaacgagtccggctatggctgtaatatccgcgcgatggcg
cgtgcagcgaaagcgctggacgatacccgcctgcttcattacgaggaagatcgcgatgcc
gaagtggtggatattatttccaccatgtacacccgcgtgccgctgatgaatctgtttggc
gaatacccgcacccgaaaccccgcatcatctgcgaatacgcacatgcaatgggtaacggt
cctggcgggttaaccgaataccagaacgtgttcgatcgccacgattgtattcaggggcac
tatgtctgggagtggtgcgaccacggtattcagacaaccgatgccagcggcaggacgttc
tacgcctacggtggcgactttggcgattacccgaacaactacaatttctgcctcgacggg
cttatctattcagatcaaaccccggggccgggcctgcgcgagtacaaacaagttatcgcg
ccggtgaaactggcctggcacaacagcgcgctgcgggttgaaaacaaactgtggttcacc
accctggatgactacagcctgcatctcgaggtgcgcgcagagggggaaacgctgcacagc
cagcagttgagcctggccgggattaccccgaacagcacgcacacccttgccgtcgcgttg
ccggagctggatgaacgggaagcttttctcaccgctcacgttcgcaagaacagccgcacg
ctgtacagcgaggccgggcatgaaatcgctacctaccagttcccgctaaaagcgcgtacc
gccagcgcaacgccatttatcgatcgcaacgccaccccgctgaagcttgaagaggatcgt
ctgagctgcacggttaccggccataacttccgcgtgagcttctcaaaactgaccggaaag
ctcagcgcctggcaggtgaacggggaagaaaaactgacccgcgatccgaagattaatttc
ttcaagccgatgattgataaccacaaacaagagttcgaaggactgtggcagcccaatcat
ctgcacatcttacaggagcatcttcgcggctttgagacagaagcctgcgacagcgaagtg
gtgatcaccacccgcacgctaattgcaccgccggtattcgattttgggatgcgctgcacc
tatcgctggcgggtggcggctgacgggcagatcaacgtcgagctgagcggcgagcgttac
ggcgactacccgcacattattccttgcatcggcgtcaccctcggtatcaacggagcgttc
gaccaggtgacctactatggccgcgggccgggcgaaaactacccggacagccagcaggcc
agcaccatcgatctgtggcacaccacggtggatgagatgtttgaaaattatcccctcccg
cagaacaacggcaaccgccagcaggtgcgctgggcatccctggcgaaccgtcagggcagc
ggagtgctggtcgttcccgagcagcctattcacttcagcgcgtggcactacaccccggag
aacattcacgcggcgcagcactgcaatgaactgcaacgcagcgatgacatcaccctgaat
cttgaccaccagctgttggggttaggttcaaattcctggggcagcgaagtgctggactcc
tggcgcgtctggttcaggccgtttagctacggatttaccctgctgccgctggagggcggg
caaagcgcgtcacgcatactggcgcagcatcagtttggcgcaggtttcttttcgacgaat
tcgcacagcgaggcagaccaatga

DBGET integrated database retrieval system