KEGG   Enterobacter asburiae LF7a: Entas_3508Help
Entry
Entas_3508        CDS       T01604                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:eas00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Entas_3508
Enzymes [BR:eas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Entas_3508
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3770681..3772501)
Genome map
AA seq 606 aa AA seqDB search
MTMQELLLEATEQRLLRQLDVQFAIMVAGEQPAVMLAAAILSRDAGEGHVCLPLSRLVCD
DKTPPALQSCFALLGDTVDWNSVLRNSSAVSDGSTPAPLILTGGRLYLNRLWRYELTVAR
YFSEANAPLPCDEVVLRQTLDGLFTSQEPIDWQKVAAAVALTRRISVISGGPGTGKTTTV
AKLLAALIQLSGEQKCRIRLAAPTGKAAARLTESLGGALQKLPLTQEQLALFPNEASTLH
RLLGAQPGSQRLRYHAGNPLHLDVLVVDEASMIDLTMMSRLIEALPAHARVIFLGDRDQL
ASVEAGAVLGDICTYASLGYTTARAQELARLTGCALDGNDNPLAGALRDSLCLLQKSYRF
GSHSGIGQLAAAVNRGDRNATRAVFSGEFGDIEKKSLQNGEEYQAMLDEALQGYQLFLAS
VQQQRPPEQVIAAFGEYQLLCALREGPFGVAGLNERLEQVLAQKRKITRLPHSRWYEGRP
VMISRNDSALGLFNGDIGIALDRGQGLRVWFLMPDGSVKSVQPSRLPEHETAWAMTVHKS
QGSEFNHAALILPSQLSPVVTRELIYTAITRARKRLSLYTDERVLVQAIATRTERRSGLS
AIFEAS
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atgacaatgcaggaattattgcttgaggccacagaacagcgcctgctgcgtcaactcgat
gtgcaattcgccattatggtggcaggcgagcagccagccgtgatgcttgcagccgccatc
ctgagccgggatgctggcgagggccatgtgtgtctgccgctttcacgactggtctgtgat
gataaaaccccgcccgcgttgcaatcctgctttgctctgctgggtgacaccgtggactgg
aacagcgtgttgcgaaattcatctgccgtgagtgacggttcgacacctgctccgctgatc
ctcaccggggggcgtttgtacctgaatcgcctgtggcgctatgagctgaccgtcgcccga
tattttagcgaggccaacgcgcctctcccctgcgatgaggtagtgcttcgtcaaacgctg
gatggcttgtttacctctcaggagccgattgactggcaaaaagtggccgctgccgtggcg
ctgacgcgtcggatttcggtgatttctggtgggccaggtacgggcaaaaccaccacggtg
gcaaaattacttgcagcgcttatccagctttctggtgaacaaaaatgccgtattcgtctg
gcggcacctaccggaaaagcggcggcgcgtctgacggaatcattaggcggcgctctgcaa
aaactgccgctcacgcaagaacagttagcgctgttccccaatgaggccagcacgctgcac
cgcttgctcggcgcacagccgggtagccagcgtctgcgttaccatgcgggtaacccactg
catcttgatgtgctggtggtggacgaagcgtccatgattgacctcacgatgatgtctcgc
ctgattgaggcattgcctgcccatgcacgcgttattttccttggcgatcgtgaccagctt
gcctccgtggaggccggcgcggtgctgggggatatttgcacctatgcaagcctgggctac
acaacggcacgtgcgcaggagctggcacgtctgaccggatgcgcgctggatggcaacgac
aacccgctcgcaggcgcattacgcgacagcctctgtctgctgcaaaaaagctaccgcttt
ggtagccattcgggcattggtcagcttgcggcggcggtaaaccgtggagatcgcaacgca
acacgcgcggtctttagcggcgagtttggcgatattgaaaagaaatcgctgcaaaatggc
gaagagtaccaggccatgcttgacgaggctttgcaggggtatcagcttttccttgccagc
gtgcagcagcaacgtcctccagagcaggtgatagccgcctttggtgaataccagcttctg
tgtgccctgagggaagggccgtttggcgtggctggtctgaacgagaggctggagcaggtg
ctggcgcagaagcgcaaaattacccgtttaccgcattcgcgctggtatgaagggcgtccg
gtgatgatctcccgtaatgatagcgcgctggggctgtttaacggtgacattggtattgcg
cttgaccgggggcaggggctgcgcgtgtggttcctgatgcccgatggcagcgtaaagtcg
gtgcagccaagccgtttacccgaacatgaaacggcctgggcgatgacggtgcataaatcg
caaggctctgagttcaaccacgcagcgctgatcttgccttcgcagctttcgccggtggtg
acccgtgaactgatttataccgcgatcacccgtgcgcgtaagcgcctgtcgctgtatacc
gatgagcgtgtactggtgcaggcaattgctacccgcacagagcgtcgtagtgggttaagc
gcaatatttgaggcaagctaa

DBGET integrated database retrieval system