KEGG   Enterobacter asburiae LF7a: Entas_3549Help
Entry
Entas_3549        CDS       T01604                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00071  Fatty acid degradation
eas00280  Valine, leucine and isoleucine degradation
eas00310  Lysine degradation
eas00362  Benzoate degradation
eas00380  Tryptophan metabolism
eas00620  Pyruvate metabolism
eas00630  Glyoxylate and dicarboxylate metabolism
eas00640  Propanoate metabolism
eas00650  Butanoate metabolism
eas00900  Terpenoid backbone biosynthesis
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
eas01120  Microbial metabolism in diverse environments
eas01130  Biosynthesis of antibiotics
eas01200  Carbon metabolism
eas01212  Fatty acid metabolism
eas02020  Two-component system
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Entas_3549
   00630 Glyoxylate and dicarboxylate metabolism
    Entas_3549
   00640 Propanoate metabolism
    Entas_3549
   00650 Butanoate metabolism
    Entas_3549
  Lipid metabolism
   00071 Fatty acid degradation
    Entas_3549
   00072 Synthesis and degradation of ketone bodies
    Entas_3549
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Entas_3549
   00310 Lysine degradation
    Entas_3549
   00380 Tryptophan metabolism
    Entas_3549
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Entas_3549
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Entas_3549
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Entas_3549
Enzymes [BR:eas01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Entas_3549
Exosome [BR:eas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Entas_3549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III DUF3103
Motif
Other DBs
NCBI-ProteinID: AEN66267
UniProt: G2S9T4
Position
complement(3820874..3822052)
Genome map
AA seq 392 aa AA seqDB search
MKDVVIVGALRTAIGCFQGALSRHSAVDLGSVVVKALVERSGIAGHEIDEVILGQVLTAG
AGQNPARQAALKGGLPNTVSAITINDVCGSGLKALHLATQAIQCGEADVVIAGGQENMSR
APHVLTDSRTGAQLGNSQLIDSLVHDGLWDAFNDYHMGVTAENLAREYGISRELQDAYAL
SSQQKARAAIDSGRFRDEIVPVSTLRQSGESVVVDTDEQPRTDASAEGLAKLNPAFETLG
SVTAGNASSINDGAAAVMMMSESKAQELDLPVLARIKAFASVGVDPALMGIAPVYATRRC
LERAGWHLSDVDLIEVNEAFAAQAISVGKMLEWDPLRVNVNGGAIALGHPIGASGCRILV
SLVHEMMKRNSRKGLATLCIGGGQGVALAIER
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaaagatgtcgttatagtgggtgcgttgcgtacggctatcggctgttttcagggagcg
ctgtcgcgccattctgccgttgatctgggcagcgtggtggtgaaggcactggtggaacgc
agcgggatcgccgggcatgaaatcgacgaagtgatcctcggtcaggtgttgactgccggt
gccgggcaaaaccctgcgcgccaggcggcgctcaaaggcggcctgccgaataccgtgtct
gcaattaccatcaacgatgtctgtggctctggtctgaaagcgctgcatcttgcgacccag
gcgatacagtgtggtgaagcggatgtggtgattgccggtgggcaggaaaacatgagccgc
gccccgcacgtcctcaccgacagccgtactggcgcgcagctgggcaacagccagcttatc
gacagcctggtgcatgacgggctgtgggatgcgttcaatgactaccacatgggcgtgacg
gcggaaaatctggcgcgtgaatacggcatcagccgtgaacttcaggatgcttacgcgcta
agctcacagcaaaaagcccgcgcggctatcgattccgggcggtttcgcgatgaaatcgtg
cctgtcagcacgctccgccagagcggtgaatctgttgttgtcgacacggatgaacaaccg
cgtaccgatgccagcgccgaagggctggctaagctgaatcccgcatttgaaaccctgggc
tcggtgacggccgggaacgcatcctcgattaatgacggtgccgcagcggtaatgatgatg
agtgaaagcaaagctcaggagctggatttacccgtactggcccgcatcaaggcgtttgcc
agcgtaggcgttgacccggccttaatggggatcgcaccggtttacgcgacccgtcgctgc
ctggagcgtgcgggctggcatctcagtgatgtggatcttattgaagtgaacgaagccttt
gcggctcaggctatttcggtaggcaaaatgctggagtgggatccactgcgcgtcaatgtc
aacggcggggcgatcgcactgggtcacccgatcggcgcatccggctgtaggatcctggtg
tcactggtccatgaaatgatgaaacgtaattcccgcaaggggctcgccacactgtgtatc
ggcggtgggcaaggggttgcgttagcgatcgaaaggtaa

DBGET integrated database retrieval system