KEGG   Enterobacter asburiae LF7a: Entas_3608Help
Entry
Entas_3608        CDS       T01604                                 

Definition
Agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Entas_3608
Enzymes [BR:eas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Entas_3608
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3880896..3881816)
Genome map
AA seq 306 aa AA seqDB search
MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIR
QVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRML
SFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFFTAPNEGLIDPNH
SVQIGIRTEFDKDNGFTVLDAGQVNDRGVDDIIAQVKQIVGDMPVYLTFDIDCLDPAFAP
GTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQ
AAKKGE
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgagcactttaggtcatcagtacgataactctctggtatctaacgcgtttggtttttta
cgccttccgatgaacttccagccatacgatagcgatgctgactgggttatcaccggcgtg
ccgtttgatatggccacctctggccgtgctggtggtcgtcatggcccggcagccattcgt
caggtatcgactaatctggcctgggagcacaaccgcttcccgtggaacttcgacatgcgc
gagcgcctgaacgtggtcgactgcggtgacctggtgtacgcctttggcgacgcgcgtgag
atgagcgaaaaactccaggcgcacgccgagaagctgctggctgccggtaagcgtatgctc
tccttcggtggtgaccatttcgtgacgctgccgctgctgcgtgcccatgcgaaacacttc
gggaaaatggcgctggtgcactttgatgcgcataccgacacctacgcgaacggctgtgaa
tttgatcacggcaccatgttcttcaccgcgccgaacgaaggcctgatcgatccgaaccac
tctgtgcagatcggtattcgtactgagttcgataaagacaacggcttcaccgtactggat
gcaggccaggtgaacgatcgtggcgtggacgacatcattgcgcaggttaagcagattgtg
ggcgatatgccggtttacctgaccttcgacatcgactgcctggatccggcatttgctccg
ggtaccggtacgccggtgatcggcggcctgacgtctgaccgtgccatcaaactggtgcgt
ggcctgaaagatttaaacatcgtgggtatggacgtggtggaagtagcgcctgcgtacgat
caatcagaaatcacggcactggctgcggcgacgctggcactggaaatgctctacatccag
gctgcgaaaaaaggcgagtaa

DBGET integrated database retrieval system