KEGG   Enterobacter asburiae: Entas_3637Help
Entry
Entas_3637        CDS       T01604                                 

Definition
citrate lyase subunit alpha
Orthology
K01643  
citrate lyase subunit alpha / citrate CoA-transferase [EC:4.1.3.6 2.8.3.10]
Organism
eas  Enterobacter asburiae
Pathway
Citrate cycle (TCA cycle)
Biosynthesis of secondary metabolites
Two-component system
Class
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:eas00020]
Environmental Information Processing; Signal transduction; Two-component system [PATH:eas02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3904864..3906387)
Genome map
AA seq 507 aa AA seqDB search
MNQTELLHVNFPHLRALAPFDTAHSATPWLNSPEEKHTRKLCASVEEAVLRSGLQDGMTI
SFHHAFREGDRVINTVVALLAKMGFKNLTLASSSLMTCNDALIEYIQSGVISRIYTSGMR
GKLADAISHGLMDEPVQIHSHGGRVKLLQDGELNIDVAFLGVPCSDEFGNANGTQGKSSC
GSLGYAMVDAHFARKVVLLAEELVPFPNMPASLVQDQVDYIVQVESVGDPAKISVGAARV
TSNPRELMIARYAADVIEHSGYFKPGFSMQTGSGAAATACTRFMEEKMERSGVKARFALG
GITGSLVDLHEKGLIEKLLDTQCFDGQAAASLAHNPNHVEISTNVYANPGSKAACCDQLD
VVILSALEIDVDFNVNVITGSDGVMRGASGGHCDVAAAANLTIVVAPLLRSRIPTVVKRV
TTRLTPGESIDVLVTDHGIAVNPARPEIRERLLEAGLKIVDIDALYERAISLTGVPKAIE
FTDKIVGVIRYRDGSVIDTVRQVKESS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagacagaacttctccatgtgaattttccccatctgcgggcgttagcccctttc
gataccgcccatagcgcgacgccgtggctgaacagcccggaagagaagcatacccgtaag
ctgtgcgcatccgttgaagaggcggtgttacgcagcggcttgcaggacggcatgaccatt
tcgtttcaccatgcgtttcgcgaaggcgaccgggtgatcaacaccgtggtggccctgctg
gcgaagatgggcttcaaaaacctgaccctggcctccagctcgctgatgacctgtaatgat
gcgctgattgaatatattcaaagcggggtgatcagccgtatttacacctccgggatgcgc
ggcaagctggcagatgccatctctcacgggctgatggacgagccggtgcaaatccactcc
cacggtggacgcgtcaaattattgcaggacggggagctgaatatcgacgttgcgttcctc
ggcgtgccgtgcagcgatgaatttggtaacgccaacggcacgcaggggaaatcgagctgc
ggttcgctgggttacgccatggtggacgcccactttgcccgtaaagtggtgctgctggcc
gaagagctggtgccattccccaatatgcccgccagcctggtgcaggatcaggtggactac
atcgtgcaggtcgagagcgtgggcgacccggccaaaatcagcgtcggcgccgcgcgcgtg
accagtaatccgcgcgagctgatgattgcccgctatgcggcggatgtgattgaacactcc
ggctatttcaaaccgggtttctccatgcagaccggttccggcgcggcggccaccgcctgc
acgcgctttatggaagagaagatggaacgcagcggcgtgaaagcacgctttgcgctcggc
gggatcaccggcagcctggtggatctgcacgaaaaagggctgattgaaaagctgcttgat
acccagtgttttgacgggcaggcggcggcatcgctggcgcacaacccgaatcacgttgag
atttccaccaacgtctacgccaaccccggcagcaaagccgcatgttgtgaccagcttgac
gttgtcatccttagtgctctggaaattgacgtcgattttaacgtgaacgtgatcaccggc
tctgacggggtgatgcgcggggcatctggcgggcactgcgatgttgccgcggcggcgaac
ctgacgattgtggtagcgccgctgttacgtagccgtattccgacggtggtgaagcgcgtg
accactcgcctgacgccgggggagagcatcgatgtgttagtcactgaccacggtattgcg
gtcaacccggcgcgcccggagatccgtgagcgtctgcttgaggccgggctgaaaatcgtc
gatatcgatgcgctgtacgagcgggctatctcgctgacaggtgtgccaaaagcgattgaa
tttaccgacaaaattgtgggtgtgatccgctaccgcgacggcagtgtgatcgacaccgtc
agacaggtgaaggagtcatcatga

DBGET integrated database retrieval system