KEGG   Enterobacter asburiae LF7a: Entas_3637Help
Entry
Entas_3637        CDS       T01604                                 

Definition
citrate lyase subunit alpha
Orthology
K01643  
citrate lyase subunit alpha / citrate CoA-transferase [EC:2.8.3.10]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Two-component system
Brite
KEGG Orthology (KO) [BR:eas00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Entas_3637
Enzymes [BR:eas01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.10  citrate CoA-transferase
     Entas_3637
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3904864..3906387)
Genome map
AA seq 507 aa AA seqDB search
MNQTELLHVNFPHLRALAPFDTAHSATPWLNSPEEKHTRKLCASVEEAVLRSGLQDGMTI
SFHHAFREGDRVINTVVALLAKMGFKNLTLASSSLMTCNDALIEYIQSGVISRIYTSGMR
GKLADAISHGLMDEPVQIHSHGGRVKLLQDGELNIDVAFLGVPCSDEFGNANGTQGKSSC
GSLGYAMVDAHFARKVVLLAEELVPFPNMPASLVQDQVDYIVQVESVGDPAKISVGAARV
TSNPRELMIARYAADVIEHSGYFKPGFSMQTGSGAAATACTRFMEEKMERSGVKARFALG
GITGSLVDLHEKGLIEKLLDTQCFDGQAAASLAHNPNHVEISTNVYANPGSKAACCDQLD
VVILSALEIDVDFNVNVITGSDGVMRGASGGHCDVAAAANLTIVVAPLLRSRIPTVVKRV
TTRLTPGESIDVLVTDHGIAVNPARPEIRERLLEAGLKIVDIDALYERAISLTGVPKAIE
FTDKIVGVIRYRDGSVIDTVRQVKESS
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagacagaacttctccatgtgaattttccccatctgcgggcgttagcccctttc
gataccgcccatagcgcgacgccgtggctgaacagcccggaagagaagcatacccgtaag
ctgtgcgcatccgttgaagaggcggtgttacgcagcggcttgcaggacggcatgaccatt
tcgtttcaccatgcgtttcgcgaaggcgaccgggtgatcaacaccgtggtggccctgctg
gcgaagatgggcttcaaaaacctgaccctggcctccagctcgctgatgacctgtaatgat
gcgctgattgaatatattcaaagcggggtgatcagccgtatttacacctccgggatgcgc
ggcaagctggcagatgccatctctcacgggctgatggacgagccggtgcaaatccactcc
cacggtggacgcgtcaaattattgcaggacggggagctgaatatcgacgttgcgttcctc
ggcgtgccgtgcagcgatgaatttggtaacgccaacggcacgcaggggaaatcgagctgc
ggttcgctgggttacgccatggtggacgcccactttgcccgtaaagtggtgctgctggcc
gaagagctggtgccattccccaatatgcccgccagcctggtgcaggatcaggtggactac
atcgtgcaggtcgagagcgtgggcgacccggccaaaatcagcgtcggcgccgcgcgcgtg
accagtaatccgcgcgagctgatgattgcccgctatgcggcggatgtgattgaacactcc
ggctatttcaaaccgggtttctccatgcagaccggttccggcgcggcggccaccgcctgc
acgcgctttatggaagagaagatggaacgcagcggcgtgaaagcacgctttgcgctcggc
gggatcaccggcagcctggtggatctgcacgaaaaagggctgattgaaaagctgcttgat
acccagtgttttgacgggcaggcggcggcatcgctggcgcacaacccgaatcacgttgag
atttccaccaacgtctacgccaaccccggcagcaaagccgcatgttgtgaccagcttgac
gttgtcatccttagtgctctggaaattgacgtcgattttaacgtgaacgtgatcaccggc
tctgacggggtgatgcgcggggcatctggcgggcactgcgatgttgccgcggcggcgaac
ctgacgattgtggtagcgccgctgttacgtagccgtattccgacggtggtgaagcgcgtg
accactcgcctgacgccgggggagagcatcgatgtgttagtcactgaccacggtattgcg
gtcaacccggcgcgcccggagatccgtgagcgtctgcttgaggccgggctgaaaatcgtc
gatatcgatgcgctgtacgagcgggctatctcgctgacaggtgtgccaaaagcgattgaa
tttaccgacaaaattgtgggtgtgatccgctaccgcgacggcagtgtgatcgacaccgtc
agacaggtgaaggagtcatcatga

DBGET integrated database retrieval system