KEGG   Enterobacter asburiae: Entas_3900Help
Entry
Entas_3900        CDS       T01604                                 

Definition
DNA polymerase III chi subunit HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
eas  Enterobacter asburiae
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:eas00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:eas00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:eas03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:eas03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:eas03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4190386..4190829
Genome map
AA seq 147 aa AA seqDB search
MKNATFYLLDNDTHQDGLSAVEQLVCEIAAERWRAGKRVLIACEDEQQAIRLDEALWSRP
PESFVPHNLSGEGPRGGAPVEIAWPQKRNSSARDVLISLRIDFADFATAFTEVVDFVPYE
ETLKQLARERYKAYRLAGFNLNTATWK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgaagaatgcaacgttctaccttctggacaacgacacccatcaggatggcctgagcgcc
gttgaacaactggtgtgtgaaattgccgcagaacgttggcgcgcgggcaaacgtgttctg
attgcctgcgaagatgagcagcaggcgatccgccttgatgaagcgctatggtcgcgcccg
ccggagagttttgttccgcataatttgtctggcgaagggccgcgcggtggcgcaccggtc
gaaattgcctggccgcagaagcgcaacagtagcgcgcgtgatgtgctgattagcttgcgc
atcgattttgcagattttgccaccgctttcacagaagtggtagactttgtcccctacgaa
gaaactttgaaacaacttgcccgcgaacgctacaaagcgtaccgcctggctggttttaac
ctgaatacggcaacctggaaataa

DBGET integrated database retrieval system