KEGG   Enterobacter asburiae LF7a: Entas_4130Help
Entry
Entas_4130        CDS       T01604                                 

Definition
(GenBank) 1,4-alpha-glucan-branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
eas  Enterobacter asburiae LF7a
Pathway
eas00500  Starch and sucrose metabolism
eas01100  Metabolic pathways
eas01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Entas_4130
Enzymes [BR:eas01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Entas_4130
Exosome [BR:eas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Entas_4130
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Malt_amylase_C Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: AEN66835
UniProt: G2S3E5
Position
complement(4412974..4415160)
Genome map
AA seq 728 aa AA seqDB search
MSDRVDRDVINALIAGHFADPFSILGMHRTDAGLEVRALLPDATEVWVIEPKTGRKVGNL
ECLDSRGFFSGVMPRRKNPFRYQLAVIWHGQQNLIDDPYSFGPLLQEMDAWLLSEGTHLR
PYETLGAHADTMDGITGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRRETGIWELFIP
GAHNGQLYKFEMIDAHGKLRIKADPYAFEAQMRPDTASLICGLPEKVTQSEERKRANRFD
APISVYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFISAAHAAGLNVILDWVPGHFPSDDFGLAEFDGTPLYEHS
DPREGYHQDWNTLIYNYGRREVTNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRSTNRIIGEQVEGAVTMAEESTDFAGVSRPASMGGLGFWYK
WNLGWMHDTLDYMKLDPVHRQYHHDKLTFGMLYNYTENFMLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWLFAFPGKKLLFMGNEFAQGREWNHDGSLDWHLLEGGDNWHHGVQ
RLVRDLNLTYRHHKALHELDFEAYGFEWLVVDDNERSVLAFVRRDKAGNEIIVVSNFTPV
PRQHYRFGINQAGKWREILNTDSMHYHGSNVGNGGLVQSDEMESHGRPNSLSLTLPPLST
IWLVREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatcgtgtggatagagacgtgattaatgcgcttattgcgggtcattttgccgac
cctttttccattctgggaatgcaccgcacagacgccgggctggaagtccgcgcactgtta
ccggacgccacagaagtgtgggtcattgaacctaaaaccgggcgtaaagtgggcaatctg
gaatgccttgattcacgcggctttttttcgggcgtaatgcctcgtcgtaaaaaccctttc
cgttatcaactcgccgttatctggcacggccagcaaaatctcattgatgatccttacagc
tttggtcctcttttacaggagatggacgcatggctgctgtctgaagggacccatttgcgc
ccttacgaaacgctgggggcacatgcagacacgatggatggcatcacgggaacccgtttt
tccgtgtgggcgccgaacgcccggcgcgtgtctgtcgtcggccagttcaactactgggac
ggccgccgtcatccgatgcgtctgcgccgtgaaaccggcatctgggagctgtttatcccc
ggcgcacacaacggccagctctacaaattcgagatgattgacgcgcacggaaagctgcgc
attaaagccgacccgtacgccttcgaagcgcaaatgcgcccggacacggcatcgctgatt
tgcggcctgccggaaaaagttacccagagcgaggagcgcaagcgagcgaaccgctttgat
gcgcctatttccgtgtatgaagtgcatcttggatcatggcgtcgccacaccgataacaat
ttctggcttagctaccgcgaactggccgatcagctggtgccgtacgccaaatggatgggc
tttacccatctggagcttttgccggttaacgaacatcctttcgacggtagttggggttat
caacccaccgggctgtatgcgccaacacgccgctttggcacacgcgatgacttccgctat
ttcatcagtgccgcacacgcggccgggctgaacgtcattctcgactgggtgcctggccat
ttcccgtcggatgattttggtctggctgaatttgatggcacccctctgtatgagcacagc
gacccgcgtgaagggtatcaccaggactggaacacgctgatctacaactacggtcgccgt
gaagtcacgaactatctggtgggtaatgccctgtactggatcgaacgttttggtattgat
gccctgcgtgtcgatgcggtggcgtcgatgatctatcgcgactacagccgtaaagaaggg
gagtggatccctaacgaatttggcggacgcgaaaatctggaagccattgagttcctgcgc
agcaccaaccgcattattggtgagcaggttgagggcgccgtcacgatggcggaagagtcg
accgacttcgcgggcgtatctcgccctgcgtcaatgggcggcctgggcttctggtacaag
tggaacctgggctggatgcacgacacgctcgactacatgaagctcgatccggttcatcgc
cagtatcaccacgataaactcaccttcgggatgctctacaactacaccgaaaacttcatg
ctgccgctgtcgcacgacgaagtggtgcatggtaaaaaatccattctcgaccggatgcct
ggcgacgcatggcagaagtttgccaacctgcgcgcctactacggctggctgtttgccttc
ccgggcaaaaaactgctgtttatgggcaacgagtttgctcaggggcgcgagtggaaccac
gacgggagccttgactggcatctgctcgaaggcggagataactggcaccacggcgttcag
cgcctggtccgtgacctgaacctgacctatcgccatcataaagccctgcacgaactcgac
ttcgaagcatacggttttgagtggctggtggtggacgataacgaacgttcggtgctggcc
tttgtccgtcgcgataaagcaggtaatgaaatcatcgtcgtcagcaactttacccctgtt
cctcgccagcattaccgcttcggcattaatcaggccggcaaatggcgcgaaatactgaac
accgattccatgcactaccacggcagtaacgtgggtaacggcgggctggtgcaaagtgat
gagatggaaagccacggacgcccgaattcactgagcctgacgttgccgccgctgagcaca
atctggctggttcgggagggtgaatga

DBGET integrated database retrieval system