KEGG   Enterobacter asburiae: Entas_4211Help
Entry
Entas_4211        CDS       T01604                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eas  Enterobacter asburiae
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:eas00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4503051..4504157)
Genome map
AA seq 368 aa AA seqDB search
MKAFRWCALAALMLAATDLRAACTWPAWEQFKKDYISESGRVIDPSDTRKITTSEGQSYA
LFFALAANDRKAFDQLLTWTRDNLAGGDLADRLPAWLWGQKDKDTWAVIDSNSASDADIW
IAWSLLEAGRLWKEPDYTRAGKALLKRIAREEVVKVPGLGSMLLPGKIGFAEENAWRFNP
SYLPPQLASYFTRFGAPWKTLRETNQRLLLETAPKGFSPDWVQYQKNKGWQLKQDKALVG
SYDAIRVYLWVGMMNDKDPQKARLLARFQPMAAVTTKQGLPPEKVDVASGKRTGHGPVGF
SASLLPFLPSRDAQAVQRQRVADHFPDNNAYYSYVLTLFGQGWDQHRFRFTEKGELIPDW
GQECASSH
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcctttcgctggtgtgcgttagcagcgttgatgctggcggcgacggatcttcgc
gccgcctgcacctggcctgcctgggagcagtttaaaaaggattacattagcgagagcggg
cgtgtcattgaccccagtgacacgcgcaaaattaccacctcagaagggcaaagctacgcc
ttgttctttgccctcgcggcgaatgaccgcaaagcgtttgaccagttgctgacgtggacg
cgcgataacctcgccggaggggatttagccgatcgtctgcccgcctggctgtggggtcag
aaagacaaagacacctgggcggttatcgattccaactccgcgtcggatgctgatatctgg
attgcctggtcactgctcgaagccggtcggttatggaaagaaccggactacacccgcgcg
gggaaggcgctgctcaaacgtattgcccgcgaggaagtggtgaaagtaccgggccttggc
tcgatgctgctgccgggcaaaatcggctttgcagaagagaatgcctggcgcttcaacccc
agctaccttcctcctcagcttgcgagctatttcactcgctttggcgcgccctggaaaacg
cttcgcgagactaatcagcgcctgttgctggagacggcaccgaaaggtttttccccggac
tgggtgcaataccagaaaaacaaaggctggcagctgaagcaggataaagccctggtcggc
agctatgacgccattcgggtttatctctgggtggggatgatgaacgacaaagacccccaa
aaagccagactgctggcgcgtttccagccgatggccgcggtgacaacgaaacagggttta
ccgccggagaaagtggatgtggcgagcgggaaacgaacgggtcacggcccggtaggattt
tctgcttctctgctgccctttttaccatcccgtgacgcgcaagccgttcagcgccagcga
gtcgctgatcactttcccgataacaacgcctattacagctacgtactgactctctttgga
caaggatgggatcagcatcgttttcgcttcaccgaaaaaggtgaattaataccggattgg
ggccaggaatgcgcaagttcacattaa

DBGET integrated database retrieval system