KEGG   Enterobacter asburiae LF7a: Entas_4219Help
Entry
Entas_4219        CDS       T01604                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Entas_4219
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Entas_4219
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4513761..4514753)
Genome map
AA seq 330 aa AA seqDB search
MRKPACAALLVMMSVLVSPFSHAGQAWEQYKARFFMPDGRIVDTGNGNVSHTEGQGFAML
MAVASDDKATFDKLWQWTDSTLKNKDNGLFYWRYNPVEANPVADKNNASDGDVLIAWALL
KADARWHDKRYSTASDSITKALIAHNVIRYAGYRVMLPGVQGFNLNSEVVLNPSYFVFPA
WQAFADRSHLQVWRELIQDGQRLLGKMGSGKANLPTDWVSLEAGGKLVPAKAWAPRMSYD
AIRIPLYITWFDKQSSLLTPWRSWFGQFSREQTPAWVNVTTNEYAPYMMEGGLLAVRDLT
MGQASGEPVITTKDDYYSASLKMLVWLAEQ
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcccgcatgtgccgcactgttggtcatgatgagtgtgttggtttcgcctttc
tcccatgcaggccaggcctgggagcaatataaggcgcgtttctttatgccggatggccgg
atagttgataccggcaatggcaatgtttcccatacggaagggcaaggttttgccatgctg
atggccgtggcgagcgatgataaagccaccttcgataagctctggcagtggacagacagc
acgctgaaaaacaaagataatgggctgttttactggcggtataacccggtggaagccaac
ccggttgccgacaaaaacaacgcatctgacggcgatgtcctgattgcatgggcgctgtta
aaagctgatgcacgctggcatgacaagcgctacagcacagcctcggatagcatcaccaaa
gcgctgattgcgcacaacgtgatccgctatgcgggatatcgggtaatgctgcctggcgtc
cagggatttaacctgaatagtgaagtggtgctgaatccttcttacttcgtgttcccggcc
tggcaggcgtttgccgatcgcagccatttacaggtctggcgcgaactgattcaggacgga
cagcgactgcttgggaaaatggggtcgggtaaagcgaatttgcccacagactgggtatct
ctggaagccggcggcaagctggttccggccaaagcctgggcaccgcggatgagctatgac
gctattcgtattccgctttatatcacctggtttgataaacaaagctcgttgctgacgccg
tggcgtagctggtttgggcaattcagtcgcgagcaaaccccggcgtgggtgaatgtcaca
accaacgagtacgcgccgtatatgatggaaggagggctactggccgttcgtgatttaacg
atggggcaggcgtctggcgaaccggtaatcacgacaaaggatgattattactccgcgagc
ctgaaaatgctggtgtggctcgcagagcaataa

DBGET integrated database retrieval system