KEGG   Enterobacter asburiae: Entas_4254Help
Entry
Entas_4254        CDS       T01604                                 

Definition
alpha/beta hydrolase fold containing protein
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
eas  Enterobacter asburiae
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:eas00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4562148..4563140)
Genome map
AA seq 330 aa AA seqDB search
MFQQKKDWETRENAFAAFSMGPLTEFWRQREEAGFTGVGNVPVRFVRFRAEKNDRVIVVC
PGRIESYVKYAELAYDLFHMGFDVLIIDHRGQGLSGRMLSDTHRGHVDNFSDYVDDLAAF
WQQEVQPGPWRKRYILAHSMGGAIATLFLQRHSHQCDAIALSAPMFGIVMRFPDWMVRHI
LDWAEGHQRIREGYAIGTGRWRALPYTMNVLTHSRQRYRRNLRFYADEPRLRVGGPTYHW
VREGILAGEQALAGAGDDNTPTLLLQAEEERVVDNRMHDRFCELRAAAGHPCEGGKPLVI
NGAYHEILFEKDAMRSVALNAIVEFFDRHN
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgtttcagcagaaaaaggattgggaaactcgagaaaacgcatttgctgctttctctatg
ggcccgcttaccgagttctggcgtcagcgtgaagaggccggatttaccggagtgggcaat
gttcctgtacgcttcgtccgttttcgggctgaaaaaaacgatcgggtcattgtggtttgc
ccgggtcgtatagagagttacgtcaaatatgccgagctggcatatgaccttttccacatg
ggttttgacgtgctgattattgaccatcgcggccaggggctttccgggcgaatgctgtcg
gacacgcaccgtggtcacgtggataatttcagcgattatgtcgacgatcttgcggcattc
tggcagcaggaagtgcagcccggcccctggcgaaaacgctatattctcgcgcattcaatg
ggcggtgccattgccacgctgttcttgcagcgccattcgcatcagtgtgatgccattgcg
ctcagcgcgcccatgtttggcatcgtgatgcgttttcctgactggatggtacgccatatt
ctcgactgggctgagggccatcagcgtattcgggaaggttatgctatcggaaccggtcgc
tggcgggcgctgccgtatacgatgaacgtgctgactcatagccgacaacggtaccgtcgt
aacctgcgtttttatgccgatgaaccgcgtttacgcgttggcggccccacctatcactgg
gtacgggaaggcattcttgccggtgagcaggcgctggcgggcgctggcgatgacaacaca
ccgacattattgcttcaggccgaagaagaacgtgtggttgataaccgtatgcacgaccgc
ttttgtgaactgcgtgccgccgccggtcacccttgtgaagggggtaaaccgctggtcata
aacggcgcgtaccatgagatccttttcgaaaaggacgccatgcgctcagtcgcgcttaac
gccattgtcgaatttttcgacaggcataactga

DBGET integrated database retrieval system