KEGG   Enterobacter asburiae LF7a: Entas_4271Help
Entry
Entas_4271        CDS       T01604                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Entas_4271
Enzymes [BR:eas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Entas_4271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4580311..4581051
Genome map
AA seq 246 aa AA seqDB search
MSILVTRPSPAGEQLVSRLRTLGQVAWSFPLIEFSPGRELPALADQMNTLQEGDLLFALS
QHAVEFAHAQLQQAGSHWPTAPRYFAIGRTTALALHTVSGIDIRYPLDREISEVLLQLPE
LQTIAGKRALILRGNGGRELLGETLSERGADVTFCECYQRNAKNYDGAEEAMRWHMRGVD
TLVVTSGEMLQQLWSLIPLWYRENWLLRCRLLVVSERLANHARELGWQDIRIADNADNDA
LLRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgagtattcttgtcacccgcccttctcccgcaggagaacaattagtgagccgtctgcgc
acactggggcaggtggcctggagttttccgttgattgaattctcccccggtcgggagctg
cctgcgctcgccgaccagatgaataccttgcaggaaggcgatctgctttttgccctgtcg
caacatgccgtggagtttgcccatgcccagttgcaacaggccggatcgcactggcccacc
gctccgcgctatttcgcgattgggcgcaccaccgcactggccctgcataccgtaagtgga
atagatattcgctatccgttagatcgggaaattagcgaagtcttgctacaattacctgaa
ttacaaactattgccggaaagcgcgcgctcattttacgcggtaacggcgggcgcgaattg
cttggcgaaaccttaagtgaacgtggtgctgacgtcacgttctgcgaatgctatcagcgc
aatgcaaaaaattatgatggcgcggaagaagcgatgcgttggcacatgcgcggcgtcgat
accctggtggtcaccagtggtgaaatgctgcaacagctctggtcgctgattccgctttgg
tatcgtgaaaactggttactccgctgtcggcttctggtcgtcagtgagcgtctggcgaac
cacgcccgggaactgggctggcaagatattcggatcgctgataacgccgacaacgatgcg
ctgctgcgcgcattacaataa

DBGET integrated database retrieval system