KEGG   Enterobacter asburiae: Entas_4302Help
Entry
Entas_4302        CDS       T01604                                 

Definition
acetolactate synthase large subunit
Orthology
K01652  
acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
eas  Enterobacter asburiae
Pathway
Valine, leucine and isoleucine biosynthesis
Butanoate metabolism
C5-Branched dibasic acid metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:eas01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:eas01230]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:eas00650]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:eas00660]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine biosynthesis [PATH:eas00290]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:eas00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4615224..4616870)
Genome map
AA seq 548 aa AA seqDB search
MNGAQWVVHALRAQGVETVFGYPGGAIMPIYDALYDGGVEHLLCRHEQGAAMAAIGYARS
TGKTGVCMATSGPGATNLITGLADALLDSVPVVAITGQVASPFIGTDAFQEVDVLGLSLA
CTKHSFLVQSLEELPRVMAEAFYVASSGRPGPVLVDIPKDIQVALGELEPHFSTVENDDA
FPHSEVDAARQMIAEAQKPMLYVGGGVGMAQAVPALRDFIAATQMPATCTLKGLGAVEAD
YPFYLGMLGMHGTKAANLAVQECDLLIAVGARFDDRVTGKLNTFAPNAKVIHMDIDPAEM
NKLRQVHVALQGDLNALLPALQQPLSISEWRQHAAEMRAEHAWRYDHPGEAIYAPLLLKQ
LSDRKPADSVVTTDVGQHQMWSAQHMTYTRPENFITSSGLGTMGFGLPTAVGAQVARPND
TVICISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFFQERYSETTLTD
NPDFLMLASAFGIPGQHITRKDQVEAALDTMLSSEGPYLLHVSIDELENVWPLVPPGASN
SQMLEKLS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaatggtgcacagtgggtagtacatgcgttgcgcgcacagggagtcgaaacagtcttc
ggttatccggggggcgcaattatgccgatttacgatgcactgtatgacggcggcgtggaa
cacctgttgtgccgacacgagcagggtgctgcaatggcggccattggctatgcgcgctct
acgggtaaaactggcgtctgcatggcaacatctggcccgggcgcaaccaacctgatcacc
ggcctggctgatgcactgcttgattctgttcctgttgttgccatcaccggccaggtggct
tctccgttcatcggtaccgatgctttccaggaagttgacgtactgggcctgtcactggcc
tgcaccaagcacagtttcctcgttcagtctctggaagagctgccgcgcgtaatggcggaa
gcgttttatgttgccagctctggccgccctggcccggttctggttgatatcccgaaagat
atccaggttgccctgggtgagctggagccgcatttctctaccgttgagaacgacgatgct
ttcccgcattccgaagtggatgcggcgcgtcagatgatagcggaagcgcaaaagccgatg
ctgtatgtcggtggtggtgtgggtatggcgcaggccgtacctgccttgcgggactttatc
gccgccacccaaatgccagccacctgtacgctgaaaggccttggggcggtagaggcagat
tacccattctatctgggcatgttggggatgcacggcaccaaagccgccaacctggcggtt
caggaatgcgacctgctgattgccgtaggcgcccgttttgatgaccgcgtaaccggcaag
ctgaataccttcgcgccgaatgcgaaggtgatccacatggatatcgaccctgcggaaatg
aataagttgcgtcaggtgcacgtggcccttcagggcgatctcaacgcgttgttgcctgct
ttacagcagccactgagcatcagtgaatggcgtcagcacgcggcagaaatgcgtgctgaa
cacgcctggcgttacgaccatccgggtgaagccatctacgcgccgttgctgctgaagcag
ttgtccgaccgtaaaccggcagacagcgtcgtcaccaccgacgtgggccagcatcagatg
tggtccgcacagcacatgacctacactcgcccggaaaacttcatcacttctagcgggctc
ggaacgatgggctttggcctgccaactgcggtaggcgcacaggttgcccgtccgaacgat
accgtcatctgtatctccggtgacggctctttcatgatgaacgttcaggagctgggcacc
gttaagcgtaagcagttaccgctgaaaatcgtcttgctcgataaccagcgcttaggcatg
gttcgccagtggcaacagttgttcttccaggagcgttacagcgaaaccaccctgaccgat
aaccccgatttcctcatgctggccagtgcttttggtatccccggccagcacatcacccgt
aaagaccaggttgaagcggcactcgacacaatgctgtcaagcgaggggccttacctgctt
catgtctcaatcgacgagcttgagaatgtctggccgttggtaccgccaggtgccagtaat
tcacaaatgctggagaaattatcatga

DBGET integrated database retrieval system