KEGG   Enterobacter asburiae LF7a: Entas_4343Help
Entry
Entas_4343        CDS       T01604                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Entas_4343
Enzymes [BR:eas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Entas_4343
Exosome [BR:eas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Entas_4343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4671336..4672844
Genome map
AA seq 502 aa AA seqDB search
MTEKKYIVALDQGTTSSRAVVMDHDANIVSVSQREFEQIYPRPGWVEHDPMEIWATQSST
LVEVLAKADISSDEIAAIGITNQRETTVVWERETGKPIYNAIVWQCRRTAEICEQLKRDG
MEEYVRSATGLVVDPYFSGTKVKWILDHVEGSRERAKRGELLFGTVDTWLIWKMTQGRVH
VTDYTNASRTMLFNINTLEWDDKMLDALDIPRAMLPEVRKSSEVYGQTNIGGKGGTRIPI
SGIAGDQQAALFGQLCVKEGMAKNTYGTGCFMLMNTGEKAVKSENGLLTTIACGPRGEVN
YALEGAVFMAGASIQWLRDEMKLISDAFDSEYFATKVKDTNGVYVVPAFTGLGAPYWDPY
ARGAIFGLTRGVNSNHIIRATLESIAYQTRDVLEAMQADSGIRLHALRVDGGAVANNFLM
QFQSDILGTRVERPEVREVTALGAAYLAGLAVGFWQNLDELQEKAVIEREFRPGIETTER
NFRYSGWKKAVKRALAWEEHEE
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaaaaaaaatatattgttgcgctcgaccagggcactaccagctcccgcgctgtc
gtaatggatcatgacgcgaatatcgtcagcgtgtcacagcgcgaattcgagcaaatctat
cctcgtccaggctgggttgagcacgacccaatggaaatctgggcaacgcaaagctccacg
ctggtagaagtgctggcgaaagccgatatcagctccgacgaaattgccgccatcggtatc
accaaccaacgtgaaaccaccgtggtgtgggagcgcgaaaccggcaagccgatttacaac
gcgatcgtctggcagtgtcgccgtaccgcagaaatctgcgaacagctcaagcgcgacggc
atggaagagtacgtgcgaagcgcaaccggcctggtggttgacccgtatttctccggaacc
aaagtgaaatggatcctcgaccacgtggaaggctcacgtgaacgtgcgaaacgcggcgaa
ctgctgttcggtaccgtcgatacctggcttatctggaagatgacccagggacgtgtccac
gtgaccgactataccaacgcttcgcgcaccatgctgttcaacatcaacaccctggagtgg
gatgacaagatgctggacgcgctggacatcccccgcgccatgctgccagaagtgcgtaag
tcttcagaagtgtacggccagaccaacatcggtggtaaaggcggcacgcgtattcctatc
tccggtatcgccggtgatcagcaggcggcgctgttcggccagctgtgcgtcaaggaaggg
atggcgaagaacacctacggaacaggctgcttcatgctgatgaacaccggcgagaaagcg
gtgaaatcagaaaacggtctgctgaccaccatcgcctgcggcccacgcggtgaagtgaac
tatgcgctggaaggtgcggtgttcatggcgggtgcgtcaatccagtggctgcgtgacgag
atgaagcttatcagcgatgcgttcgactccgaatacttcgccaccaaagtgaaggacacc
aacggcgtgtacgtggtgcctgcgttcaccggcctcggtgcaccatactgggacccgtac
gctcgcggcgcgattttcggcctgacgcgtggtgtgaactccaaccacatcatccgcgcc
acgctggaatccatcgcctaccagacacgcgatgttctggaagcaatgcaggctgactcc
ggtattcgtctgcacgccctgcgcgtggacggtggcgcggttgccaacaacttcctgatg
cagttccagtccgacattctgggtacccgtgtagagcgcccggaagtccgtgaggtgact
gcactgggtgcggcatacctggcgggcctggcggtgggcttctggcagaacctggacgag
cttcaggaaaaagcggtaatcgaacgtgaattccgtcctggcatcgaaaccaccgagcgt
aacttccgctacagcggctggaagaaagcggtgaaacgcgccctggcgtgggaagagcac
gaagagtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system