KEGG   Enterobacter asburiae LF7a: Entas_4348Help
Entry
Entas_4348        CDS       T01604                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Entas_4348
   01230 Biosynthesis of amino acids
    Entas_4348
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Entas_4348
   00051 Fructose and mannose metabolism
    Entas_4348
   00562 Inositol phosphate metabolism
    Entas_4348
Enzymes [BR:eas01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Entas_4348
Exosome [BR:eas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Entas_4348
  Exosomal proteins of bladder cancer cells
   Entas_4348
  Exosomal proteins of melanoma cells
   Entas_4348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4676075..4676842
Genome map
AA seq 255 aa AA seqDB search
MRHPLVMGNWKLNGSRHMVNELVANLRKELAGVTGCAVAIAPPDMYLDLAKHAADGSHIV
LGAQNVDVNLSGAFTGETSAEMLKDIGAKYIIIGHSERRTYHKESDEFIAKKFAVLKEQG
LIPVLCIGETEAENEAGKTEEVCARQIDAVLKTQGAAAFEGAVIAYEPVWAIGTGKSATP
AQAQAVHKFIRDHIAKADAKVAEQVIIQYGGSVNAANAAELFTQPDIDGALVGGASLKAD
AFAVIVKAAEAAKQA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgcgacatcctttagtgatgggtaactggaaactgaacggcagccgccacatggtaaac
gaactggttgctaacctgcgtaaagagctggctggcgtaactggctgcgcggttgctatc
gctccgcctgatatgtacctggatctggctaaacacgcggctgacggcagccacatcgtt
ctgggtgcacagaacgttgacgttaacctgtctggcgcattcaccggtgaaacttccgct
gaaatgctgaaagatatcggcgcgaaatacatcatcatcggtcactcagagcgtcgtacc
taccacaaagaatccgacgagttcatcgcgaagaaattcgctgtgctgaaagagcagggt
ctgatcccggttctgtgcatcggtgaaaccgaagcagaaaacgaagcaggcaaaactgaa
gaagtgtgcgcacgtcagatcgacgcagtgctgaaaactcagggcgcggcagcgttcgaa
ggcgcagtcattgcttacgagccagtctgggctatcggtaccggcaaatcagcaacccct
gcgcaggctcaggctgttcacaaattcattcgtgaccacatcgctaaagcagacgcgaaa
gtggctgaacaagtcatcattcagtacggcggttccgtaaacgcggctaacgctgctgag
ctgttcacccagccagacatcgatggcgcgctggttggcggcgcatccctgaaagctgac
gctttcgcggtgatcgttaaagcagcagaagcggctaaacaggcgtaa

DBGET integrated database retrieval system