KEGG   Enterobacter asburiae LF7a: Entas_4372Help
Entry
Entas_4372        CDS       T01604                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Entas_4372
  Lipid metabolism
   00561 Glycerolipid metabolism
    Entas_4372
   00600 Sphingolipid metabolism
    Entas_4372
Enzymes [BR:eas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Entas_4372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4700578..4702701)
Genome map
AA seq 707 aa AA seqDB search
MQDFILRLESKTVDVVIKTHPFAEIIYWGPHLGHFSPQDVASLSRPVANGRLDVDSPVTL
MAELGHGLFGSPGIEGHRQGLDGSPVFKTSDVQLQGQTLTVTAEDEHAGLRLTSELALDA
SGVLVVRHGLTNLKAQPWQVDRFAVTLPVAERAQEVMAFHGRWIHEFQPHRVTLEHNSFV
IENRRGKTSHEHFPALISGTSSFSEMQGDVWGVHLGWSGNHRLRAEAKTDGRRYLQAEAL
YLPGEMAINEGETLWTPRLFASYSAKGLNGMSQQFHRYLRDNIIRFPENKPRPVHLNTWE
GIYFNHDPDYIMRMADEAAALGVERFIIDDGWFKGRNDDHAALGDWYLDEKKYPNGLAPV
INHVKSLGMEFGIWVEPEMINPDSDLYRAHPDWVLALPGYTQATGRHQLVLNLNIPEAFD
YLVERMSWLLGEHAVDYVKWDMNRELVQPGHKGRAAADAQTRQFYRLLDVLGGRFPHIEF
ESCSSGGGRIDYEVLTRSHRFWASDNNDALERNTIQRGMSYFFPPEVMGAHIGHHKCHAT
FRQHSIAFRGLTALFGHMGLELDPLTVDEQEREGYRHYAALHKQWREVIHHGTQWRVDMP
DSSTLAQGIVSEDKTQGLFIVSQLAMPDYALMMPLRMPGLEASAQYRITLLDHPNIQITG
KGGHTMRKLPVWMETPQTVSGEWLMQAGIALPILDPETAILIGVERV
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgcaagatttcattttacgactcgaaagcaagacggttgacgtggtgatcaaaactcac
ccgttcgccgaaattatctactgggggccgcatcttggccacttttcaccacaggatgtc
gcaagtctctcgcgaccggtggccaacggcaggctggatgtggattcccctgtcacgctg
atggcggagctgggccacggtttatttggctcgcccgggattgaggggcatcggcagggg
ctggacggctccccggtattcaagacctctgatgtgcaactacaggggcaaaccctgacg
gtgaccgcagaagatgaacacgcaggcctgcgtctgaccagtgagctggcgctggatgcc
agtggcgtgctggtggtgcgtcatggtttgactaacctgaaagcgcagccctggcaggtg
gatcgcttcgccgtgacgctgccggtggccgagcgtgcgcaggaggttatggctttccac
gggcgctggatccacgaatttcagccacaccgcgtaacgcttgagcacaacagttttgtg
atagaaaaccgtcgcggaaaaacatcccatgagcatttcccggcgctgatctcaggcacc
tcgtctttcagtgaaatgcagggtgacgtctggggcgtacatctgggctggagcggtaac
caccgtctgcgtgccgaagccaaaacggacggacgccgttatctccaggccgaagcgctc
tatctgccaggggaaatggcgattaacgaaggggaaacactctggacgccgcgcctgttt
gcgagttactccgcgaaagggctgaacggcatgagccagcagtttcatcgctacctgcgt
gacaacattatccgcttcccggaaaacaaaccgcgcccggtgcatctcaacacctgggag
gggatctacttcaaccacgacccagactacatcatgcggatggctgatgaagcggccgcg
ctgggcgtcgagcgctttatcatcgacgacggctggttcaaaggccgtaacgatgaccat
gccgcgctgggtgactggtatctggacgagaagaaatacccgaacgggctggcaccggtg
attaaccatgtgaaaagtctcggcatggaatttggtatctgggttgagccggagatgatt
aaccctgattcggatctttaccgtgcacatccagactgggtgctggcgctaccgggttac
acgcaagcgacggggcgccatcaactcgtgcttaatctcaacatccctgaagcttttgat
tatctggtagaacgtatgagctggctgctgggtgaacatgcggtcgactacgtgaaatgg
gatatgaaccgcgagctggtgcagccggggcacaaaggtagagcggccgccgatgcacaa
acgcgccagttctatcgtctgttggatgtgctgggtgggcgcttcccgcatattgaattt
gaatcctgttcttcaggcggcggacgcatcgactatgaggtgttgacccgcagccaccgt
ttctgggcttctgataataacgacgcgctggagcgcaacaccattcagcgcggcatgagc
tatttcttcccgccggaggtgatgggcgcgcatatcggtcatcataaatgccatgccacc
ttccgccagcacagcatcgcattccgtggcctgactgcgctgtttggccatatggggctg
gagctggatccgctcaccgtcgatgaacaggagcgcgaagggtatcgccattacgcggcg
ctgcataaacagtggcgcgaggttatccatcacggtacccagtggcgggtggatatgccg
gacagcagcaccctggcgcagggtatagtgagcgaagacaaaacgcaggggctgtttatt
gtcagccagttggcaatgccggattacgccctgatgatgccgctgcgaatgccggggctg
gaggccagcgcgcaatatcgcatcactctgctcgatcacccaaacattcaaatcacaggc
aagggtgggcacaccatgcgcaagttgccggtatggatggaaacaccacaaacggtgagc
ggcgagtggctgatgcaggcggggatcgcgctgccgatcctggacccggaaaccgccatt
ctgattggcgtagaacgcgtataa

DBGET integrated database retrieval system