KEGG   Enterobacter asburiae LF7a: Entas_4419Help
Entry
Entas_4419        CDS       T01604                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
eas  Enterobacter asburiae LF7a
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:eas00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Entas_4419
Enzymes [BR:eas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Entas_4419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4754172..4755101)
Genome map
AA seq 309 aa AA seqDB search
MKTAGNLVVLGSINADHILNLESFPTPGETVTGNQYQVAFGGKGANQAVAAGRSGAQIAF
IACTGDDDTGERVRKQLASDNIDIAPVSVVAGESTGVALIFVNAEGENVIGIHAGANAAL
TTERVEAQRDIIASAEALLMQLESPVESVLAAAKIAHENHTTVVLNPAPARVLSDELLAL
VDIITPNETEAEKLTGIRVENDDDAARAAKALHDKGIGNVIITLGSRGVWASVNGEGRRV
PGFKVEAIDTIAAGDTFNGALVTALLEGKAQDQAIRFAHAAAAIAVTRKGAQPSVPWRKE
IDEFLSQQG
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccgctggcaacctcgttgttcttggcagtatcaatgccgatcacattcttaac
cttgaatctttcccgacacctggcgaaaccgtcaccggtaaccagtaccaggtggcattt
ggcggcaaaggcgcaaaccaggctgttgctgccggtcgcagcggcgcacagattgcgttt
attgcctgtacgggtgatgacgacacgggtgaacgcgtacgtaaacaactggcaagcgac
aacatcgatattgcgccagtaagcgtggtggccggggaatcaacaggcgtagcgctgatt
ttcgttaatgcggaaggtgagaatgtcatcggtattcatgctggggctaatgcggcgctg
acaaccgaacgcgttgaagcgcagcgcgacattattgccagtgcagaagcattattaatg
cagctggagtccccggtggaaagcgtactggctgcggccaaaattgcgcatgaaaatcat
accactgtcgtacttaatccggcgcctgcccgtgtattatctgatgagctcctggcgctg
gtggatatcatcacccctaacgaaaccgaagctgaaaagctgaccggtattcgtgtggaa
aatgacgacgatgcggcgcgtgcggcgaaagctctgcacgacaaaggtatcggcaacgtt
atcattaccctcggcagccgcggtgtgtgggccagcgtcaacggcgaaggccgtcgcgtg
ccgggctttaaggtggaagcgattgataccattgcggccggggatacctttaacggtgcg
ctggtgacggcgttgctggaaggtaaggcgcaggatcaggctattcgttttgctcatgcc
gctgccgctatcgcggtcacccgcaaaggtgcgcagccttccgttccgtggcgtaaagag
atcgatgaattcttaagtcagcaggggtaa

DBGET integrated database retrieval system