KEGG   Exiguobacterium sp. AT1b: EAT1b_0083Help
Entry
EAT1b_0083        CDS       T00897                                 

Definition
histidinol dehydrogenase (EC:1.1.1.23)
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    EAT1b_0083
  Amino acid metabolism
   00340 Histidine metabolism
    EAT1b_0083
Enzymes [BR:eat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     EAT1b_0083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
63532..64749
Genome map
AA seq 405 aa AA seqDB search
MSTETNRSRREAWAEAVKPIVESIEARGDEALLKWTKQFDGVDRIESVDLASFNPPVAYA
ELTEALSLAAERIRTFHARQVRQDDVFEDTMFRLGRRYMPLDSVGVYVPGGTAVYPSSVL
MNIIPAKVAGVKRVVMVTPPKADGIDISLLIAAKIAGADECFLIGGAQAVAALAYGTETI
RPVDKIVGPGNAYVATAKALVSHIVGIDSVAGPSEVLIIADETANPKWVAADLLAQAEHD
VEATAIAIVTSETLRDQIEQELERQLVQLPRQDIARESLKRGGVLYRTIEDAIEYANTMA
AEHVQLAVKDPEVLMRAIRHGGSFFLGHEAAEAFGDYIAGPNHVLPTSGTARFSSGLSVD
DFYRRQTFLEMTELDETITKAAIRIAKQEQLEGHARAMAVRMEDV
NT seq 1218 nt NT seq  +upstreamnt  +downstreamnt
atgagtacagaaacgaatcgctcaaggcgcgaagcttgggccgaagccgtgaaaccaatc
gtggaatcgattgaagcccgcggagacgaagcgctgcttaagtggacgaaacaattcgac
ggggtcgatcgaatcgaatcggtcgatttggcaagctttaatccgccagtcgcatatgct
gaattgacagaggcgctgtcgttagcagcagaacggattcgtacatttcacgcgcgccaa
gtccgacaagacgatgtgttcgaagatacgatgttccgacttgggagacgctatatgcca
cttgattcggtaggggtttatgtaccaggtgggacagccgtctatccgtcgagcgtcctg
atgaatatcattccggcgaaagtggccggtgtcaaacgagtcgtcatggtcaccccacca
aaagcagatgggatcgacatttccctcttgattgcagcaaaaatcgcaggtgccgatgaa
tgttttctaatcggaggtgcccaagccgttgccgcactcgcatatgggacagaaacgatt
cgtccggtcgataagattgtcggacccggaaatgcgtatgttgcgacggcgaaggcgctc
gtctcacacatcgtcgggatcgactccgtcgccggaccgtccgaagtgttgatcattgcc
gatgaaacggcgaacccgaagtgggttgccgccgacctgctcgcacaagcggaacatgac
gtcgaggcgacggcaatcgcgatcgtcacgtcagaaaccctccgcgatcaaatcgagcaa
gaacttgagcgacaattagtgcaattaccacgccaggacattgcgagagaatcattgaaa
cgtggcggcgtcttgtatcggacaatcgaggatgcaatcgaatacgcgaacacgatggcc
gcggagcacgtccagttggccgtcaaagatcctgaggtgttgatgcgtgcgattcgtcac
ggtggttcgttctttctcggacatgaggcggccgaagcatttggagactatatcgctgga
ccgaaccacgtcttgcctacgagcgggacggcccgcttctctagtggactatcggtcgat
gacttttatcgccgtcagacattccttgagatgacagaactggatgagacgattacaaag
gccgcgattcgaatcgccaaacaagaacaattagaaggacacgcccgtgcgatggctgtt
cggatggaggacgtatga

DBGET integrated database retrieval system