KEGG   Exiguobacterium sp. AT1b: EAT1b_0155Help
Entry
EAT1b_0155        CDS       T00897                                 

Definition
bifunctional acetaldehyde-CoA/alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    EAT1b_0155
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0155
   00620 Pyruvate metabolism
    EAT1b_0155
   00650 Butanoate metabolism
    EAT1b_0155
  Lipid metabolism
   00071 Fatty acid degradation
    EAT1b_0155
  Amino acid metabolism
   00350 Tyrosine metabolism
    EAT1b_0155
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    EAT1b_0155
   00626 Naphthalene degradation
    EAT1b_0155
Enzymes [BR:eat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     EAT1b_0155
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     EAT1b_0155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
130883..133474
Genome map
AA seq 863 aa AA seqDB search
MAVKEKAKVETTAEQMVDTLVASAHKALDTLMTFDQEKIDHIVQAMALAGLEQHVALAKL
AHTETGRGVFEDKMIKNIFATEYIYNSLRGEKTVGVLEDDVQNGITYIAEPVGVVAGVTP
VTNPTSTTMFKAIIAIKTRNPIIFAFHPSAQQCSSEAARVLRDAAVAAGAPENLIQWVEV
PSLDATKALMNHPGVAMVLATGGAAMVKSAYSTGKPALGVGPGNVPAYIDKTAKVKRAIS
DVILSKTFDNGMICASEQAIIVDQEVYEEVKAEMTALGCYFCSPEEKAKLETLVIRTDTC
AVNPEIVGKPAAWIAEQAGLKVPADTKILIAELETVGATELLSHEKLSPVLGAYKVQSRE
EGFAIAEKMLEIGGLGHTAVIHSTDDDAILEFGLRMKACRIIVNSPSAHGGIGDLYNEMT
PSLTLGCGSYGKNSVSENVTAKHLLNVKKVARRRVNMQWFKVPEKIYFEKNSVQYLQSLT
TKKRAMIVTDEMMVKLGFADKVIKNLPAGVEYRIFDQVEPDPSVETVMNGAEAMRHFQPD
MIIALGGGSPMDAAKGMWLFYERPEEKFSNLRQKFMDIRKRTYKFPTLGNKSMFIAIPTT
SGTGSEVTPFTVITDKKRNVKYPIADYAITPDVAIVDPEFVMTVPASITADTGMDVMTHA
IEAYVSVMANDYTDGLCLRAIKMIFDYLPKAYENGSDAEARQKVHNASTMAGMAFANAFL
GINHSIAHKIGGEFHVPHGRTNAILMPHVIRYNATRPSKLAAFPKYESFIADERYAEIAR
YLGLPASTTAEGVESLVQAIIELGQRLNIKLSFKAQGIKKAELDAKIDKMAVDAFEDQCT
TANPKMPLVEELKEIMYAAYEGV
NT seq 2592 nt NT seq  +upstreamnt  +downstreamnt
atggcagtcaaagagaaagcaaaagtggaaacaacggcagaacaaatggtggacacgctc
gtagcaagtgcgcataaggcactcgatacgttgatgacgttcgaccaagagaaaatcgat
cacatcgtacaggcgatggcgcttgcgggactcgagcaacacgtcgcactcgcgaagtta
gcacatacagaaacaggtcgcggtgtctttgaagacaagatgatcaaaaacattttcgcg
acagaatatatctataactcactccgtggtgagaaaacggtcggcgttcttgaagacgac
gttcaaaacggaatcacatacatcgcagaaccagtcggtgtcgtcgctggggtcacaccg
gtcacgaacccaacatcgacaacgatgttcaaagcgatcatcgccatcaagacacgtaac
ccgattatcttcgcgttccatccatcagcgcaacaatgttcaagcgaagcggctcgtgtc
ctccgtgacgcagcagtggcggcaggtgctcctgaaaacttgattcaatgggttgaagtt
ccgtcactcgatgcgacgaaagcgctcatgaaccaccctggtgtagcgatggtccttgcg
acgggtggggcagcgatggtcaaatcggcttactcgactggtaaaccagcactcggtgtc
ggacctggtaacgtaccggcctacatcgataagactgcgaaagtgaaacgtgccatctca
gacgtcatcctttcaaaaacgttcgacaacggaatgatctgtgcgtctgaacaagcgatc
atcgtcgatcaagaagtatatgaagaagtgaaagcagagatgacggcactcggttgctac
ttctgctcaccagaagaaaaagcaaaacttgaaacactcgtcattcgtacagatacatgt
gcggtcaaccctgaaatcgtcgggaagccggcagcatggatcgctgaacaggcaggtctc
aaagtaccagcggatacgaagatcttgattgcagagcttgaaacagttggcgcaacggaa
cttctttctcacgaaaaattaagcccggttctcggtgcgtataaagttcaatcacgtgaa
gaaggatttgcaatcgctgaaaaaatgctcgagattggtggtctcggtcacacggcggtc
atccactcaacagatgacgatgccatccttgagttcggtctccgtatgaaagcttgccgc
atcatcgtcaactcaccttcagcacatggtggaatcggtgacctttataacgaaatgaca
ccatccctcacgctcggttgtgggtcttacggtaaaaactccgtctcagaaaacgtgacg
gcgaaacatctactcaacgtgaaaaaggtggcgagacgtcgcgtgaatatgcaatggttc
aaagtacctgaaaaaatctatttcgagaaaaactcagtacaataccttcaatcgctcaca
acgaaaaaacgggcgatgatcgtcacagatgaaatgatggtcaaactcggattcgctgac
aaagtcatcaaaaacttgccggctggtgtcgagtaccgcatcttcgaccaagtcgaaccg
gatccatctgttgaaacggtcatgaacggtgccgaagcgatgcgtcacttccaaccagac
atgatcatcgcacttggtggtggttcaccgatggatgctgcgaaaggcatgtggctcttc
tacgaacgtccagaagagaagttctcgaatctacgccagaaatttatggatattcgcaaa
cggacgtataagttcccgacactcggtaacaagtcaatgtttatcgccatcccgacaacg
tcaggtacaggttctgaagtgacaccgttcactgtcatcacagataaaaaacgtaacgtg
aaatatccgattgctgactatgcgatcacaccagacgtcgccatcgtcgaccctgagttc
gtcatgaccgtcccagcttcaatcacggctgatacaggaatggacgtcatgacacacgca
atcgaagcatatgtttccgtcatggcgaatgattacacagacggactttgcctccgcgcc
atcaagatgatcttcgactacctaccaaaagcgtatgaaaacggtagcgatgcggaagct
cgtcagaaagtacacaacgcttcaacgatggcgggtatggcgtttgcgaacgcgttcctc
ggaatcaaccactcgatcgctcacaaaatcggtggagagttccacgtcccacacggtcgt
acgaacgcgattctcatgccacacgtcatccgttacaacgcgacacgcccatcgaaactt
gcggcgttcccgaaatatgagtcattcatcgctgacgaacgttacgcagaaatcgcgcgt
tacctcggacttccagcaagcacgacagctgaaggtgtcgagtcactcgtccaagcgatc
atcgagctcggtcaacgcttgaacatcaaactttcgttcaaggcgcaaggtatcaagaaa
gcagaacttgatgcgaagatcgacaagatggcggtcgacgcattcgaagaccaatgtacg
acggccaacccgaaaatgccgctcgttgaagaattaaaagaaatcatgtacgcagcatac
gaaggcgtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system