KEGG   Exiguobacterium sp. AT1b: EAT1b_0231Help
Entry
EAT1b_0231        CDS       T00897                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:eat00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
200364..201146
Genome map
AA seq 260 aa AA seqDB search
MKQLQDKIALVTGAASGIGLEIAEEFAEAGAKIAIVDIQLEKAHIAASQLKEKGYDVIAV
EADVTKEEAIKRSIDQTMEAYGRIDIVINNAAMQHVSPLEEFPTEKFDLLQSIMLRAPFL
YTKHVFPIMKEQRFGRIINMASINGLIGFAGKAAYNSAKHGVIGLTKVAALEGATSGITV
NAICPGYVDTPLVQQQLDDLARTRNVAKERVLEEVIYPLVPQHRLLQVKEVADYAIFLAS
EQAKGITGQAAVIDGGYVAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaattacaagataaaattgcactagtgacaggggccgctagtggaatcgggtta
gagattgccgaagagtttgcggaagctggagcaaaaatcgccattgtcgacattcagctt
gaaaaagctcatattgctgcgagtcagctaaaagaaaagggatacgatgtgattgcagtt
gaggcggatgtgacgaaagaagaagcaatcaaacgcagtatcgatcagacgatggaggca
tatgggcgtatcgatattgtaatcaacaatgcagccatgcagcatgtttcgccacttgaa
gaattcccgacagagaagtttgacttgcttcaaagtatcatgcttcgtgcaccgttcttg
tatacaaaacatgtctttccgattatgaaagaacaacgattcggacgaatcatcaatatg
gcatccatcaacggcctgattgggtttgctggtaaagcagcctacaacagtgcgaagcac
ggggtaatcggactcacaaaagtcgctgcgctcgagggggcgacttcagggattaccgtg
aatgcgatttgtcctggctatgtggacactccgcttgtgcaacaacaactcgatgatttg
gcaagaacccgtaacgttgcaaaagaacgagtactcgaggaagtcatctacccactcgtg
ccgcaacatcgtcttttacaagtgaaagaagttgcagattatgcaatcttcctcgcaagt
gaacaggcaaaaggaatcacgggacaagccgctgtcatcgatggcggatacgtcgctcaa
taa

DBGET integrated database retrieval system