KEGG   Exiguobacterium sp. AT1b: EAT1b_0231Help
Entry
EAT1b_0231        CDS       T00897                                 

Definition
3-hydroxybutyrate dehydrogenase
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Butanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00650 Butanoate metabolism
    EAT1b_0231
  Lipid metabolism
   00072 Synthesis and degradation of ketone bodies
    EAT1b_0231
Enzymes [BR:eat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.30  3-hydroxybutyrate dehydrogenase
     EAT1b_0231
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
200364..201146
Genome map
AA seq 260 aa AA seqDB search
MKQLQDKIALVTGAASGIGLEIAEEFAEAGAKIAIVDIQLEKAHIAASQLKEKGYDVIAV
EADVTKEEAIKRSIDQTMEAYGRIDIVINNAAMQHVSPLEEFPTEKFDLLQSIMLRAPFL
YTKHVFPIMKEQRFGRIINMASINGLIGFAGKAAYNSAKHGVIGLTKVAALEGATSGITV
NAICPGYVDTPLVQQQLDDLARTRNVAKERVLEEVIYPLVPQHRLLQVKEVADYAIFLAS
EQAKGITGQAAVIDGGYVAQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacaattacaagataaaattgcactagtgacaggggccgctagtggaatcgggtta
gagattgccgaagagtttgcggaagctggagcaaaaatcgccattgtcgacattcagctt
gaaaaagctcatattgctgcgagtcagctaaaagaaaagggatacgatgtgattgcagtt
gaggcggatgtgacgaaagaagaagcaatcaaacgcagtatcgatcagacgatggaggca
tatgggcgtatcgatattgtaatcaacaatgcagccatgcagcatgtttcgccacttgaa
gaattcccgacagagaagtttgacttgcttcaaagtatcatgcttcgtgcaccgttcttg
tatacaaaacatgtctttccgattatgaaagaacaacgattcggacgaatcatcaatatg
gcatccatcaacggcctgattgggtttgctggtaaagcagcctacaacagtgcgaagcac
ggggtaatcggactcacaaaagtcgctgcgctcgagggggcgacttcagggattaccgtg
aatgcgatttgtcctggctatgtggacactccgcttgtgcaacaacaactcgatgatttg
gcaagaacccgtaacgttgcaaaagaacgagtactcgaggaagtcatctacccactcgtg
ccgcaacatcgtcttttacaagtgaaagaagttgcagattatgcaatcttcctcgcaagt
gaacaggcaaaaggaatcacgggacaagccgctgtcatcgatggcggatacgtcgctcaa
taa

DBGET integrated database retrieval system