KEGG   Exiguobacterium sp. AT1b: EAT1b_0417Help
Entry
EAT1b_0417        CDS       T00897                                 

Definition
(RefSeq) phosphoglycerate mutase
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_0417
   01230 Biosynthesis of amino acids
    EAT1b_0417
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0417
  Energy metabolism
   00680 Methane metabolism
    EAT1b_0417
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    EAT1b_0417
Enzymes [BR:eat01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     EAT1b_0417
Exosome [BR:eat04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   EAT1b_0417
  Exosomal proteins of melanoma cells
   EAT1b_0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(381583..382143)
Genome map
AA seq 186 aa AA seqDB search
MTTIYFVRHAHSTYTPDEFARPLSERGMRDVAEITNLLIDEGIDIVTSSPYKRAVQTVQG
IADYLGQDVVVMDDLRERTLTSEPAKDFTSAMETVWKNPAFAWEGGESNVQAQSRGIEAL
QSLLRTYEGKKVVLGTHGNIMVLMLNYFDARYGYDFWKKLDMPDLYKATFENNTLMSVDK
LYKSQD
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccatatattttgtcagacatgcacattctacctatacaccagacgaatttgcc
agaccgttatccgaaagaggaatgcgtgatgtagctgaaattacaaatcttctaatcgat
gaggggatcgatatcgtgacgtcgagtccatataaacgagccgttcaaaccgtacaaggt
atcgcggattatcttggacaggacgttgtagtaatggatgatttgagagagcgaaccttg
acttcagaaccggctaaagactttacaagcgcgatggagaccgtttggaaaaatcctgcg
ttcgcatgggaaggtggagaatcgaacgttcaggctcaatctagaggaatagaggctcta
caatcactgctccgtacgtacgaagggaaaaaagtggtgctcggcacacatggaaatatt
atggttctcatgttgaattattttgatgcgcgatatggatatgatttttggaaaaaactc
gacatgcctgatctctataaggcgacttttgagaacaatacattgatgagtgtcgataag
ttatataaatctcaagattag

DBGET integrated database retrieval system