KEGG   Exiguobacterium sp. AT1b: EAT1b_0550Help
Entry
EAT1b_0550        CDS       T00897                                 

Definition
ROK family glucokinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_0550
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0550
   00052 Galactose metabolism
    EAT1b_0550
   00500 Starch and sucrose metabolism
    EAT1b_0550
   00520 Amino sugar and nucleotide sugar metabolism
    EAT1b_0550
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    EAT1b_0550
   00524 Butirosin and neomycin biosynthesis
    EAT1b_0550
Enzymes [BR:eat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     EAT1b_0550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(498168..499130)
Genome map
AA seq 320 aa AA seqDB search
MKWLLGIDIGGTTVKMAVLDMNGIISDKWEVKTDIRENGVHIPKDIAASFETYLQTSGKK
KEDFAGAGIGAPGFVNFSEGVVEYSPNIGWKDFALVSEFEKAVGLPAVLENDANAAALGE
MWKGAGEGASELLAITLGTGVGGGVITNGNIVHGTAGMAGEIGHITVERDETKAVKCGCG
RLGCIETIASATGISRLALQKRKNQDTSLNELKEVTARDVFEAYKAGDSIATEVIEEMTE
YLGLTISNIANTLNPKMIVIGGGVSKAGDALLEPLDAQFKRFALERVYESTTFKIAELEN
DAGVIGCAWLARKHFLPTRV
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaaatggttattaggtatcgacatcggtggtacgacggtgaagatggccgttttagac
atgaacggcatcatttcggataagtgggaagtcaaaacggatattcgagagaatggtgta
catattccaaaagacatcgcagcttcttttgaaacatacttacaaacatcaggtaagaag
aaagaagattttgcgggtgcgggaatcggggcaccaggattcgtcaacttctcagaagga
gttgtcgaatattctccgaacatcgggtggaaagattttgctctcgtgagtgagttcgaa
aaagcagtcggtcttccggccgtgctcgaaaatgatgcgaacgccgcggcccttggtgag
atgtggaaaggtgccggcgaaggggcatcagaattattggcgatcacgctcggtacaggt
gtcggtggtggcgtgatcacgaacggaaatatcgttcatgggacggcaggaatggccgga
gaaatcgggcatattaccgtggaacgagacgaaacgaaagctgtgaagtgtggttgtggt
cgcctcgggtgtattgagacgattgcttcagcgaccggcatctcgcgtttggcgttacag
aagcgtaaaaatcaagatacttcattaaacgagttaaaagaagtgactgcacgtgacgtg
tttgaagcatataaggctggtgactcgatcgcgacagaagtcattgaagagatgacggaa
tacctcggcttgaccatctcaaacatcgcgaacacgctcaatccgaaaatgattgtcatc
ggtggaggtgtctcaaaagctggtgacgcgttattggagccgcttgatgcacagttcaaa
cggtttgcgctcgagcgggtatacgagtcgacaacattcaaaatcgctgaactcgaaaac
gatgccggtgtgattggatgtgcttggctggcacggaaacacttccttccgacacgagta
tga

DBGET integrated database retrieval system