KEGG   Exiguobacterium sp. AT1b: EAT1b_0670Help
Entry
EAT1b_0670        CDS       T00897                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    EAT1b_0670
   01230 Biosynthesis of amino acids
    EAT1b_0670
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0670
   00030 Pentose phosphate pathway
    EAT1b_0670
   00051 Fructose and mannose metabolism
    EAT1b_0670
   00052 Galactose metabolism
    EAT1b_0670
  Energy metabolism
   00680 Methane metabolism
    EAT1b_0670
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    EAT1b_0670
Enzymes [BR:eat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     EAT1b_0670
Protein phosphatases and associated proteins [BR:eat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     EAT1b_0670
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(623098..624066)
Genome map
AA seq 322 aa AA seqDB search
MNLKRIAVLTSGGDAPGMNAAVRAVTRKAIFEGLEVYGVYNGYQGLIEGDLVELNLGSVG
DIIQRGGTFLRSARCPEFRTEEGRAKAVEQLKKFNIDALVVIGGDGSYRGAQKLTELGFP
TIGLPGTIDNDIPGTDATIGFDTALNTALDAIDKIRDTASSHERTYVIEVMGRDAGDIAL
YSGLAGGAESILVPERPEDLNAIVERINHGIARGKKHSIVIVAEGAGSAEEIGKLIAEKT
NSETRVTILGHIQRGGSPTAADRVLASRMGAYAVEILLEGKAGRVVGIRNNQMMDLDIDE
ALDNNKHTIDMQLIDLVNQLSI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
gtgaatttaaaacgtattgcggtattaacaagcggaggagacgctcctggaatgaacgct
gctgtccgtgccgtgacccgaaaagcaatttttgaaggtcttgaagtgtacggcgtgtat
aacggctatcaaggattaatcgaaggtgatttagtcgaattaaatcttggatcagtcggc
gatatcattcaacgtggaggtacgttccttcgctctgcgcgctgtcctgaattcagaaca
gaagaaggtcgcgcgaaagcagtagaacagttgaagaagttcaatatcgatgccctcgtg
gtcattggtggagatggctcttatcgcggagctcaaaaattgactgaactcggattccca
acaatcggccttccgggtacaatcgataacgatatcccaggaacagatgcgacaatcggt
tttgacacggcgctcaacacagcgcttgatgcgatcgataagattcgtgatacggcttca
tcacatgaacgcacgtatgtcatcgaggtcatggggcgcgacgctggtgatatcgcgctt
tattctggtctcgctggtggtgctgagtcgattctcgtcccagaacgtccagaagatttg
aatgcaatcgtggaacgaatcaatcacgggattgcacgcggtaagaagcactcaatcgtc
atcgttgctgaaggtgcaggaagtgcggaagaaatcggcaaattgattgctgagaagacg
aactcagaaacacgcgtcacgattctcggtcacatccaacgtggtggttccccaactgcc
gctgaccgtgtccttgcaagtcgcatgggtgcatacgctgttgagatcttgctcgaaggg
aaggcgggccgcgttgtcggaatccgtaacaaccaaatgatggatctcgatatcgatgag
gcgctcgacaacaacaagcacacgattgatatgcaattgattgacctcgtcaaccagttg
tcgatttaa

DBGET integrated database retrieval system