KEGG   Exiguobacterium sp. AT1b: EAT1b_0695Help
Entry
EAT1b_0695        CDS       T00897                                 

Definition
(GenBank) AMP-dependent synthetase and ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
eat  Exiguobacterium sp. AT1b
Pathway
eat00010  Glycolysis / Gluconeogenesis
eat00620  Pyruvate metabolism
eat00640  Propanoate metabolism
eat00680  Methane metabolism
eat01100  Metabolic pathways
eat01110  Biosynthesis of secondary metabolites
eat01120  Microbial metabolism in diverse environments
eat01130  Biosynthesis of antibiotics
eat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:eat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    EAT1b_0695
   00620 Pyruvate metabolism
    EAT1b_0695
   00640 Propanoate metabolism
    EAT1b_0695
  Energy metabolism
   00680 Methane metabolism
    EAT1b_0695
Enzymes [BR:eat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     EAT1b_0695
Lipid biosynthesis proteins [BR:eat01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   EAT1b_0695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C
Motif
Other DBs
NCBI-ProteinID: ACQ69626
JGI: EAT1b_0695
UniProt: C4L4A4
Position
complement(650974..652686)
Genome map
AA seq 570 aa AA seqDB search
MTMEKLKALTGEHQLASYEEACQSFEWTQAEALFSWNLTGKVNLAYEAIDRHAESELATK
VALLYFDGDREERYTYADMKKESNRSGNVLKSIGVEKGDRVFIFMPRQPELYFILLGAIK
RGAIVGPLFEAFMEQAVHDRLLDSEAKVIVTTKELLPRIPVDQLPHLETILLVGDEVEES
DKVLDYRKLANDATTDLELTWVDREDGLILHYTSGSTGKPKGVLHVHNAMIQHMMTGKWV
LDLQPDDIYWCTADPGWVTGTSYGIFAPFLNGATNVIVGGRFNPEFWYSVIERFGVTVWY
SAPTAFRMLMGAGDEAFEKYDLSSLRHILSVGEPLNPEVIRWGHEAFDLRIHDTWWMTET
GAMMICNYPTMDIKPGSMGKPIPGCEAAILDDRGQPLPPHRMGNLALKTPWPSMMRKIWK
NDAKYESYFWGDWYVSGDSAYMDEDGYFWFQGRVDDVIMTAGERVGPFEVESRLVEHPAV
AEAGVIGKPDPVRGEIIKAFIALRKGYEPSDELKQEIQQFVKEGLAAHAAPREIEFKDKL
PKTRSGKIMRRVLKAWELNLETGDLSTMED
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
ttgacgatggaaaaattgaaagcgttaacaggggagcatcaattagcgtcgtatgaagag
gcttgtcagtcgtttgagtggacacaagcagaagcattgttttcttggaatttgacgggg
aaagtcaatttggcatatgaagccatcgaccgccatgcggaaagtgaattggcgacaaaa
gtggcactgctttatttcgatggggatcgagaagagcggtacacgtatgcggatatgaag
aaagaaagtaatcgttctggtaatgttctgaagtcgattggtgtggaaaaaggcgaccgc
gtctttatctttatgccacgtcagccagaactttattttattttgctcggtgccatcaaa
cgaggggcgattgtcggtccactctttgaggcgttcatggaacaggcggtccacgaccgt
ttgctcgactcggaagcgaaagtgatcgtgacgacgaaagagttgttgccacgcatcccg
gtcgatcagttacctcatttggagacaattctactcgttggggacgaagtcgaggaatcg
gacaaggtgctcgattatcgtaaactggcgaacgatgcgacgacagatctcgaattgacg
tgggtcgaccgtgaagacggtctgattttgcactatacatcgggctcaacaggaaaacca
aaaggggttctccacgtccataatgcgatgattcaacatatgatgaccggcaagtgggta
ctcgaccttcaaccggatgatatttactggtgcaccgctgacccgggatgggtgacgggg
acgagctatggtatttttgcacccttcttaaacggtgcgacgaacgtcatcgtgggggga
cgcttcaatcccgaattctggtattcagtcattgaacggtttggcgtgacggtctggtac
agtgctccgacggcgttccgcatgctcatgggcgcaggggacgaagcgtttgagaaatat
gatttgtcttcacttcgtcatattttatccgtcggtgaaccgttgaaccctgaagtcatt
cgctgggggcacgaggcgtttgacctccgaatccacgacacgtggtggatgacagagaca
ggcgccatgatgatttgtaactatccgacgatggacatcaaacctggatcgatggggaaa
ccgatcccaggttgcgaggcagccatcttggacgaccggggtcagccgctaccgccgcac
cggatggggaacttggcactcaagacgccatggccgtcgatgatgcggaaaatctggaag
aacgatgcgaagtatgagagttacttctggggagattggtatgtatcgggcgactcggct
tacatggatgaagacggatacttctggttccaaggacgtgtcgacgacgtcatcatgacg
gcaggagaacgtgtcggaccgtttgaagtcgaaagtcgcctcgtagagcacccggcggtc
gctgaagcaggtgtcatcggcaaaccggacccggttcgaggagaaatcatcaaagcgttc
attgcgctacgtaaaggctatgaaccgtctgatgagttaaaacaagaaatccaacaattc
gtcaaagaaggattggctgcgcatgcggcaccacgtgaaatcgaattcaaggacaagttg
ccgaaaacgcgaagcgggaaaatcatgcgtcgtgtcttgaaggcttgggaattgaatctc
gaaacaggtgacctctcgacgatggaagattaa

DBGET integrated database retrieval system